Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7IP51

Protein Details
Accession A0A1J7IP51    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-24KNPNKPSKNRLAARANKVKKHydrophilic
55-74TSGPRKPVSAKRQRKLDKKLBasic
NLS Segment(s)
PositionSequence
8-80NKPSKNRLAARANKVKKRSQKESAAGRLHAGVVKSDLKRGARPGLLPTSGPRKPVSAKRQRKLDKKLGYALKR
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPSVKNPNKPSKNRLAARANKVKKRSQKESAAGRLHAGVVKSDLKRGARPGLLPTSGPRKPVSAKRQRKLDKKLGYALKRKMEADGEVEMKDVVTEDVVSKAKTSKGEEKMELDIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.78
3 0.77
4 0.79
5 0.81
6 0.79
7 0.77
8 0.78
9 0.78
10 0.77
11 0.77
12 0.76
13 0.74
14 0.74
15 0.74
16 0.77
17 0.78
18 0.72
19 0.63
20 0.55
21 0.46
22 0.37
23 0.31
24 0.22
25 0.13
26 0.12
27 0.17
28 0.16
29 0.18
30 0.21
31 0.21
32 0.22
33 0.25
34 0.26
35 0.22
36 0.23
37 0.24
38 0.24
39 0.23
40 0.21
41 0.2
42 0.24
43 0.23
44 0.24
45 0.21
46 0.2
47 0.24
48 0.33
49 0.41
50 0.45
51 0.54
52 0.59
53 0.69
54 0.75
55 0.8
56 0.8
57 0.79
58 0.76
59 0.7
60 0.71
61 0.7
62 0.68
63 0.67
64 0.65
65 0.61
66 0.56
67 0.52
68 0.47
69 0.4
70 0.34
71 0.29
72 0.25
73 0.21
74 0.19
75 0.19
76 0.16
77 0.14
78 0.12
79 0.1
80 0.06
81 0.05
82 0.05
83 0.06
84 0.1
85 0.12
86 0.12
87 0.13
88 0.15
89 0.18
90 0.22
91 0.29
92 0.34
93 0.41
94 0.47
95 0.5
96 0.51