Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7JGU0

Protein Details
Accession A0A1J7JGU0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MVKKRKNNGRNKKGRGHVNPIRCBasic
82-101KIVRVRSREGRRNRAPPPRVBasic
NLS Segment(s)
PositionSequence
3-16KKRKNNGRNKKGRG
85-109RVRSREGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 15.5, mito_nucl 12, nucl 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRKNNGRNKKGRGHVNPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKVVPTNNPHPQKAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.83
4 0.8
5 0.79
6 0.78
7 0.76
8 0.71
9 0.63
10 0.61
11 0.56
12 0.55
13 0.54
14 0.54
15 0.54
16 0.57
17 0.62
18 0.65
19 0.69
20 0.71
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.68
27 0.68
28 0.6
29 0.52
30 0.46
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.12
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.05
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.1
55 0.16
56 0.18
57 0.2
58 0.23
59 0.23
60 0.24
61 0.26
62 0.24
63 0.19
64 0.19
65 0.18
66 0.19
67 0.19
68 0.21
69 0.21
70 0.28
71 0.3
72 0.31
73 0.34
74 0.39
75 0.48
76 0.55
77 0.61
78 0.65
79 0.69
80 0.75
81 0.8
82 0.81
83 0.79
84 0.8
85 0.79
86 0.8
87 0.8
88 0.78
89 0.78
90 0.78
91 0.8
92 0.79
93 0.78
94 0.69
95 0.71
96 0.71
97 0.71
98 0.7
99 0.68
100 0.68
101 0.72
102 0.75
103 0.67