Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7JS20

Protein Details
Accession A0A1J7JS20    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-62FSISIQRRSRWQRRANRPHEKCLLPHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 16, cyto 6.5, cyto_nucl 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MLIAVELDVHVTAAVSTGQYIDVRATFTGMVDVTLVSFSISIQRRSRWQRRANRPHEKCLLPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.05
5 0.06
6 0.06
7 0.06
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.03
24 0.03
25 0.03
26 0.1
27 0.13
28 0.18
29 0.21
30 0.24
31 0.33
32 0.43
33 0.53
34 0.56
35 0.64
36 0.7
37 0.79
38 0.88
39 0.9
40 0.91
41 0.87
42 0.86
43 0.84