Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7JDF7

Protein Details
Accession A0A1J7JDF7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-86IHFATMKPEQKKKKDPKKDAGKAPAKRLPBasic
NLS Segment(s)
PositionSequence
66-89EQKKKKDPKKDAGKAPAKRLPFLR
Subcellular Location(s) cyto 10, plas 6, cyto_mito 6, extr 4, E.R. 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSQRASIIAADGGQFGWFAKIGATPEAVNVLNDQPVLFTILIVVLLAVILQCLLIWYIHFATMKPEQKKKKDPKKDAGKAPAKRLPFLRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.06
5 0.06
6 0.06
7 0.08
8 0.09
9 0.1
10 0.11
11 0.1
12 0.1
13 0.12
14 0.12
15 0.1
16 0.1
17 0.1
18 0.09
19 0.09
20 0.09
21 0.06
22 0.07
23 0.08
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.04
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.03
43 0.05
44 0.05
45 0.08
46 0.08
47 0.08
48 0.13
49 0.21
50 0.29
51 0.34
52 0.42
53 0.5
54 0.59
55 0.69
56 0.76
57 0.79
58 0.83
59 0.86
60 0.88
61 0.91
62 0.91
63 0.9
64 0.9
65 0.88
66 0.84
67 0.83
68 0.78
69 0.7
70 0.65