Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7IRB1

Protein Details
Accession A0A1J7IRB1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
43-65SSSRSTKFPKQPVRPPRRKRAVIHydrophilic
NLS Segment(s)
PositionSequence
51-62PKQPVRPPRRKR
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGATFSSAKRLSGLGWTCATCRNNAVRPELRRIAAPFRQYASSSRSTKFPKQPVRPPRRKRAVIWAATGTGVATGVLAGVLAFGDQIKYSYDAAERTGRVASGLAICINE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.24
4 0.25
5 0.25
6 0.31
7 0.31
8 0.24
9 0.27
10 0.3
11 0.34
12 0.36
13 0.43
14 0.44
15 0.47
16 0.54
17 0.52
18 0.47
19 0.43
20 0.42
21 0.42
22 0.39
23 0.38
24 0.32
25 0.3
26 0.31
27 0.29
28 0.29
29 0.27
30 0.29
31 0.29
32 0.28
33 0.33
34 0.37
35 0.43
36 0.48
37 0.53
38 0.55
39 0.6
40 0.68
41 0.73
42 0.79
43 0.82
44 0.82
45 0.83
46 0.83
47 0.8
48 0.72
49 0.72
50 0.7
51 0.63
52 0.58
53 0.48
54 0.39
55 0.35
56 0.32
57 0.2
58 0.11
59 0.08
60 0.05
61 0.03
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.04
75 0.06
76 0.08
77 0.09
78 0.1
79 0.12
80 0.13
81 0.16
82 0.21
83 0.2
84 0.19
85 0.2
86 0.18
87 0.17
88 0.16
89 0.15
90 0.12
91 0.13