Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NTZ7

Protein Details
Accession C0NTZ7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
123-151VKKPAQSDGPPRKRGRPRKNPSDPPKPVPBasic
NLS Segment(s)
PositionSequence
107-173PRKRGRPPKLDATGNPVKKPAQSDGPPRKRGRPRKNPSDPPKPVPAGPKRGRGRPRKDDPTAPSKKP
197-206PSKRGRPKKS
Subcellular Location(s) plas 11, mito 4, cyto_nucl 4, nucl 3.5, cyto 3.5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MNGVIPTTIDKCSGPLIRPGSESGKRLAHVSCPPRAQRTSRYFPLFASPAIFFFFFVFIITITTTFFFVVVFVFFALPAVTAAPIRTIGHCPPSTTFPAAMADAPLPRKRGRPPKLDATGNPVKKPAQSDGPPRKRGRPRKNPSDPPKPVPAGPKRGRGRPRKDDPTAPSKKPRLSTDAAATTTTTISSSSKPAPTPSKRGRPKKSATEGAAKAVNGAGATGFLLDKIIGIYSLDCKEVEDNWPDDAEEMELTITRTSESPLGLIGGFNLGVIQGTMLFAADKRTLDKFRAVMSKRGRVAGGARGGNGEGETGSSDDGDDIPHAAGPAHVKDLRVYFSWRGRSTGEGEIHTEEGTSPQDGYLVFTSDEAITFNGVAGFPALGENCKFKGTKIDDDAADAPEPWTSFSRQAAEEAAVRRWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.34
4 0.35
5 0.37
6 0.4
7 0.41
8 0.43
9 0.43
10 0.4
11 0.39
12 0.37
13 0.38
14 0.36
15 0.34
16 0.38
17 0.42
18 0.44
19 0.48
20 0.52
21 0.57
22 0.61
23 0.61
24 0.62
25 0.65
26 0.67
27 0.68
28 0.7
29 0.63
30 0.58
31 0.59
32 0.51
33 0.42
34 0.36
35 0.28
36 0.22
37 0.24
38 0.22
39 0.15
40 0.14
41 0.14
42 0.11
43 0.11
44 0.1
45 0.08
46 0.09
47 0.09
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.08
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.09
72 0.09
73 0.11
74 0.15
75 0.17
76 0.25
77 0.25
78 0.26
79 0.27
80 0.31
81 0.33
82 0.31
83 0.29
84 0.22
85 0.23
86 0.22
87 0.2
88 0.16
89 0.14
90 0.14
91 0.19
92 0.2
93 0.22
94 0.24
95 0.29
96 0.37
97 0.47
98 0.52
99 0.57
100 0.61
101 0.67
102 0.72
103 0.72
104 0.64
105 0.61
106 0.62
107 0.56
108 0.5
109 0.43
110 0.37
111 0.34
112 0.37
113 0.32
114 0.31
115 0.33
116 0.43
117 0.52
118 0.6
119 0.66
120 0.67
121 0.73
122 0.75
123 0.8
124 0.81
125 0.81
126 0.81
127 0.84
128 0.91
129 0.92
130 0.91
131 0.91
132 0.86
133 0.79
134 0.77
135 0.67
136 0.6
137 0.59
138 0.57
139 0.57
140 0.55
141 0.6
142 0.57
143 0.64
144 0.7
145 0.71
146 0.73
147 0.73
148 0.78
149 0.77
150 0.76
151 0.75
152 0.71
153 0.72
154 0.69
155 0.64
156 0.63
157 0.6
158 0.59
159 0.56
160 0.54
161 0.5
162 0.46
163 0.44
164 0.41
165 0.38
166 0.35
167 0.3
168 0.27
169 0.21
170 0.18
171 0.15
172 0.09
173 0.07
174 0.07
175 0.08
176 0.11
177 0.13
178 0.15
179 0.16
180 0.2
181 0.28
182 0.31
183 0.39
184 0.45
185 0.52
186 0.6
187 0.7
188 0.73
189 0.73
190 0.76
191 0.76
192 0.75
193 0.71
194 0.65
195 0.63
196 0.55
197 0.48
198 0.43
199 0.33
200 0.26
201 0.19
202 0.16
203 0.08
204 0.07
205 0.04
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.04
219 0.06
220 0.07
221 0.08
222 0.08
223 0.08
224 0.09
225 0.1
226 0.13
227 0.14
228 0.14
229 0.14
230 0.14
231 0.14
232 0.13
233 0.12
234 0.09
235 0.06
236 0.05
237 0.05
238 0.05
239 0.06
240 0.06
241 0.05
242 0.05
243 0.06
244 0.07
245 0.08
246 0.08
247 0.08
248 0.07
249 0.08
250 0.08
251 0.07
252 0.06
253 0.05
254 0.05
255 0.04
256 0.04
257 0.03
258 0.03
259 0.03
260 0.03
261 0.02
262 0.03
263 0.03
264 0.03
265 0.03
266 0.04
267 0.07
268 0.08
269 0.09
270 0.11
271 0.16
272 0.18
273 0.2
274 0.24
275 0.23
276 0.26
277 0.35
278 0.35
279 0.39
280 0.44
281 0.49
282 0.47
283 0.47
284 0.42
285 0.35
286 0.35
287 0.33
288 0.33
289 0.26
290 0.24
291 0.23
292 0.23
293 0.21
294 0.18
295 0.12
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.05
302 0.05
303 0.06
304 0.06
305 0.06
306 0.06
307 0.06
308 0.06
309 0.07
310 0.07
311 0.06
312 0.08
313 0.1
314 0.11
315 0.15
316 0.16
317 0.17
318 0.19
319 0.21
320 0.23
321 0.22
322 0.26
323 0.27
324 0.32
325 0.4
326 0.39
327 0.39
328 0.38
329 0.39
330 0.39
331 0.4
332 0.36
333 0.29
334 0.31
335 0.3
336 0.29
337 0.26
338 0.22
339 0.14
340 0.13
341 0.13
342 0.12
343 0.1
344 0.09
345 0.1
346 0.1
347 0.13
348 0.13
349 0.13
350 0.12
351 0.12
352 0.14
353 0.13
354 0.13
355 0.11
356 0.1
357 0.09
358 0.08
359 0.09
360 0.08
361 0.08
362 0.07
363 0.07
364 0.07
365 0.06
366 0.08
367 0.08
368 0.09
369 0.11
370 0.15
371 0.15
372 0.19
373 0.19
374 0.19
375 0.28
376 0.32
377 0.4
378 0.43
379 0.47
380 0.44
381 0.49
382 0.5
383 0.42
384 0.36
385 0.28
386 0.22
387 0.18
388 0.18
389 0.16
390 0.17
391 0.18
392 0.21
393 0.25
394 0.29
395 0.28
396 0.3
397 0.29
398 0.29
399 0.31
400 0.3