Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NXL4

Protein Details
Accession C0NXL4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-77GSLAAGPGRRRRRRKRRRGLMTQGAIDBasic
NLS Segment(s)
PositionSequence
57-69PGRRRRRRKRRRG
Subcellular Location(s) plas 9, cyto 5.5, mito 5, cyto_nucl 4.5, E.R. 3, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MLDSGIPGQDGGWGRAVIRIPSHESLGAQKHSPAAFEAEVEVEVLSSCWEGSLAAGPGRRRRRRKRRRGLMTQGAIDIRRCETASGGKSRVVLLCVLRSMEAALVAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.2
4 0.17
5 0.17
6 0.19
7 0.22
8 0.23
9 0.25
10 0.22
11 0.21
12 0.24
13 0.27
14 0.26
15 0.21
16 0.21
17 0.23
18 0.22
19 0.22
20 0.18
21 0.16
22 0.14
23 0.13
24 0.13
25 0.09
26 0.09
27 0.09
28 0.08
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.05
40 0.05
41 0.06
42 0.09
43 0.11
44 0.19
45 0.29
46 0.38
47 0.48
48 0.59
49 0.69
50 0.78
51 0.88
52 0.91
53 0.92
54 0.94
55 0.94
56 0.93
57 0.91
58 0.84
59 0.73
60 0.64
61 0.54
62 0.45
63 0.35
64 0.26
65 0.18
66 0.15
67 0.15
68 0.13
69 0.14
70 0.2
71 0.24
72 0.29
73 0.29
74 0.29
75 0.29
76 0.31
77 0.3
78 0.24
79 0.21
80 0.18
81 0.19
82 0.19
83 0.19
84 0.17
85 0.16
86 0.15
87 0.13