Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7IIQ6

Protein Details
Accession A0A1J7IIQ6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
336-363SEGPAKGGRKQGKKNQKKEPEVPDRFKVBasic
NLS Segment(s)
PositionSequence
340-366AKGGRKQGKKNQKKEPEVPDRFKVVKK
Subcellular Location(s) cyto_nucl 15, nucl 12, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR032466  Metal_Hydrolase  
IPR001130  TatD-like  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
Pfam View protein in Pfam  
PF01026  TatD_DNase  
CDD cd01310  TatD_DNAse  
Amino Acid Sequences MAASASTDSTASGPSGDGQTPRDSGYQPRYIDIGINLADPIFRGRYHGTQRHPDDLKGVIQRAKEVGCTKLIVTGSSFKSSRDALKLAEEFPGTVYTTAGIHPCSSSIFSISHKRHHEDDEDHSADEQHTPACGPDPSKPVPDGLSVSEEKTTQIISDLTSLIKSAPSSSLVAFGEFGLDYDRLHYCPQDIQLHSFAAQLRLAAELTPQLPLFLHSRAAHRDFVRLLKDAFGPRLERLEKGGVVHSFTGTVEEMRELSQLGLHIGVNGCSFKTTENCDVVKEIGLDRLMIETDGPWCEVRPSHEGWKYLLPPKPVGAEANVADSGSATPALSNGTSEGPAKGGRKQGKKNQKKEPEVPDRFKVVKKEKWEEGAMVKGRNEPCTIERIAKIVAGIKGIAVEEVCEAAWANTVKVFGLDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.16
4 0.17
5 0.19
6 0.23
7 0.23
8 0.25
9 0.26
10 0.25
11 0.31
12 0.37
13 0.41
14 0.39
15 0.39
16 0.38
17 0.36
18 0.36
19 0.29
20 0.25
21 0.18
22 0.17
23 0.16
24 0.14
25 0.13
26 0.11
27 0.13
28 0.11
29 0.11
30 0.15
31 0.19
32 0.27
33 0.37
34 0.45
35 0.49
36 0.57
37 0.63
38 0.68
39 0.66
40 0.58
41 0.51
42 0.46
43 0.45
44 0.4
45 0.4
46 0.34
47 0.32
48 0.34
49 0.33
50 0.31
51 0.3
52 0.27
53 0.25
54 0.24
55 0.24
56 0.22
57 0.24
58 0.24
59 0.19
60 0.19
61 0.23
62 0.24
63 0.28
64 0.28
65 0.24
66 0.27
67 0.28
68 0.3
69 0.28
70 0.27
71 0.24
72 0.3
73 0.31
74 0.29
75 0.29
76 0.25
77 0.2
78 0.19
79 0.2
80 0.14
81 0.12
82 0.11
83 0.09
84 0.09
85 0.1
86 0.11
87 0.1
88 0.09
89 0.09
90 0.1
91 0.11
92 0.11
93 0.11
94 0.11
95 0.12
96 0.15
97 0.25
98 0.27
99 0.34
100 0.37
101 0.41
102 0.42
103 0.45
104 0.47
105 0.42
106 0.45
107 0.46
108 0.43
109 0.39
110 0.36
111 0.33
112 0.27
113 0.24
114 0.18
115 0.1
116 0.08
117 0.08
118 0.08
119 0.09
120 0.1
121 0.11
122 0.15
123 0.21
124 0.23
125 0.26
126 0.26
127 0.25
128 0.25
129 0.25
130 0.21
131 0.17
132 0.19
133 0.17
134 0.17
135 0.17
136 0.16
137 0.14
138 0.13
139 0.12
140 0.07
141 0.08
142 0.08
143 0.07
144 0.09
145 0.09
146 0.08
147 0.08
148 0.08
149 0.07
150 0.08
151 0.07
152 0.07
153 0.07
154 0.09
155 0.1
156 0.1
157 0.13
158 0.12
159 0.12
160 0.11
161 0.1
162 0.09
163 0.08
164 0.08
165 0.06
166 0.06
167 0.06
168 0.08
169 0.09
170 0.09
171 0.1
172 0.1
173 0.09
174 0.11
175 0.15
176 0.19
177 0.19
178 0.21
179 0.22
180 0.22
181 0.22
182 0.22
183 0.18
184 0.13
185 0.13
186 0.1
187 0.08
188 0.09
189 0.08
190 0.06
191 0.06
192 0.06
193 0.06
194 0.07
195 0.06
196 0.06
197 0.06
198 0.08
199 0.09
200 0.09
201 0.12
202 0.12
203 0.15
204 0.19
205 0.22
206 0.24
207 0.23
208 0.25
209 0.23
210 0.25
211 0.25
212 0.22
213 0.19
214 0.17
215 0.2
216 0.19
217 0.19
218 0.17
219 0.17
220 0.16
221 0.21
222 0.2
223 0.18
224 0.19
225 0.2
226 0.19
227 0.18
228 0.21
229 0.16
230 0.16
231 0.16
232 0.13
233 0.11
234 0.1
235 0.11
236 0.08
237 0.07
238 0.06
239 0.07
240 0.07
241 0.07
242 0.07
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.07
249 0.06
250 0.07
251 0.07
252 0.08
253 0.07
254 0.08
255 0.07
256 0.07
257 0.07
258 0.08
259 0.1
260 0.15
261 0.19
262 0.23
263 0.24
264 0.24
265 0.25
266 0.24
267 0.22
268 0.18
269 0.14
270 0.12
271 0.12
272 0.11
273 0.1
274 0.1
275 0.09
276 0.08
277 0.07
278 0.05
279 0.07
280 0.08
281 0.09
282 0.08
283 0.08
284 0.1
285 0.12
286 0.15
287 0.18
288 0.21
289 0.29
290 0.33
291 0.34
292 0.35
293 0.4
294 0.41
295 0.44
296 0.44
297 0.39
298 0.36
299 0.36
300 0.36
301 0.31
302 0.27
303 0.22
304 0.21
305 0.18
306 0.2
307 0.18
308 0.15
309 0.14
310 0.13
311 0.11
312 0.08
313 0.08
314 0.05
315 0.05
316 0.06
317 0.07
318 0.07
319 0.07
320 0.08
321 0.09
322 0.1
323 0.11
324 0.11
325 0.11
326 0.15
327 0.17
328 0.21
329 0.28
330 0.36
331 0.45
332 0.54
333 0.63
334 0.7
335 0.79
336 0.84
337 0.86
338 0.88
339 0.88
340 0.87
341 0.88
342 0.88
343 0.87
344 0.84
345 0.77
346 0.74
347 0.69
348 0.64
349 0.64
350 0.62
351 0.59
352 0.62
353 0.65
354 0.64
355 0.65
356 0.63
357 0.56
358 0.51
359 0.53
360 0.47
361 0.43
362 0.39
363 0.4
364 0.4
365 0.39
366 0.37
367 0.32
368 0.3
369 0.33
370 0.34
371 0.32
372 0.31
373 0.31
374 0.3
375 0.26
376 0.26
377 0.25
378 0.24
379 0.19
380 0.18
381 0.15
382 0.15
383 0.15
384 0.14
385 0.09
386 0.08
387 0.08
388 0.08
389 0.08
390 0.07
391 0.08
392 0.07
393 0.12
394 0.12
395 0.13
396 0.14
397 0.14
398 0.14