Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7JIL3

Protein Details
Accession A0A1J7JIL3   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-99SASSPTAPKKRPTKKRKVQAESDEDDHydrophilic
NLS Segment(s)
PositionSequence
80-90APKKRPTKKRK
105-123KKEAKAKKEAKVEEKKPKD
Subcellular Location(s) nucl 14, cyto_nucl 12.833, cyto 10.5, mito_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MPPLDTESQFKFLISCIKHSNSGKIDFVEVANELGIVTKAAAAKRYERLMKAHDIAPKGALSGGVASAGGPAGSASSPTAPKKRPTKKRKVQAESDEDDEIPDVKKEAKAKKEAKVEEKKPKDEGKHSDDGSFMLSDIPEAPPGFVKKEASCDSGAGTGGYADADVCHDCTTEQAVKHESGFGHEHTSSPHPLTCLDNGGAFSHPITPTAAMQSFGYQTNSGFQSLAQAQAPSPTRMMEPPDGSAGVFPSGSWVQTGPQHYYWDENAQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.3
4 0.33
5 0.41
6 0.43
7 0.5
8 0.47
9 0.49
10 0.46
11 0.41
12 0.39
13 0.32
14 0.3
15 0.23
16 0.18
17 0.14
18 0.12
19 0.1
20 0.08
21 0.08
22 0.07
23 0.06
24 0.05
25 0.07
26 0.1
27 0.11
28 0.15
29 0.17
30 0.21
31 0.26
32 0.32
33 0.35
34 0.35
35 0.39
36 0.4
37 0.44
38 0.43
39 0.42
40 0.4
41 0.37
42 0.35
43 0.33
44 0.28
45 0.22
46 0.18
47 0.14
48 0.1
49 0.08
50 0.07
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.05
63 0.07
64 0.11
65 0.16
66 0.23
67 0.26
68 0.34
69 0.44
70 0.54
71 0.63
72 0.71
73 0.78
74 0.81
75 0.88
76 0.91
77 0.88
78 0.87
79 0.85
80 0.81
81 0.73
82 0.65
83 0.56
84 0.45
85 0.37
86 0.28
87 0.2
88 0.12
89 0.09
90 0.07
91 0.07
92 0.1
93 0.17
94 0.23
95 0.28
96 0.38
97 0.43
98 0.49
99 0.56
100 0.58
101 0.61
102 0.65
103 0.67
104 0.68
105 0.69
106 0.65
107 0.62
108 0.62
109 0.57
110 0.54
111 0.53
112 0.49
113 0.49
114 0.47
115 0.43
116 0.37
117 0.33
118 0.26
119 0.19
120 0.13
121 0.07
122 0.06
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.09
131 0.1
132 0.11
133 0.12
134 0.12
135 0.17
136 0.19
137 0.2
138 0.2
139 0.18
140 0.18
141 0.17
142 0.16
143 0.1
144 0.08
145 0.05
146 0.05
147 0.05
148 0.04
149 0.03
150 0.03
151 0.04
152 0.04
153 0.05
154 0.05
155 0.06
156 0.06
157 0.06
158 0.1
159 0.13
160 0.13
161 0.15
162 0.17
163 0.18
164 0.19
165 0.2
166 0.16
167 0.16
168 0.18
169 0.16
170 0.18
171 0.17
172 0.17
173 0.18
174 0.21
175 0.2
176 0.19
177 0.19
178 0.16
179 0.18
180 0.2
181 0.19
182 0.18
183 0.16
184 0.16
185 0.16
186 0.16
187 0.15
188 0.13
189 0.12
190 0.13
191 0.12
192 0.12
193 0.13
194 0.12
195 0.12
196 0.16
197 0.16
198 0.14
199 0.14
200 0.15
201 0.16
202 0.16
203 0.17
204 0.14
205 0.13
206 0.17
207 0.18
208 0.17
209 0.15
210 0.13
211 0.17
212 0.17
213 0.2
214 0.16
215 0.16
216 0.15
217 0.21
218 0.24
219 0.2
220 0.2
221 0.19
222 0.2
223 0.22
224 0.28
225 0.27
226 0.27
227 0.27
228 0.29
229 0.28
230 0.26
231 0.24
232 0.2
233 0.14
234 0.12
235 0.1
236 0.13
237 0.13
238 0.13
239 0.14
240 0.13
241 0.14
242 0.2
243 0.24
244 0.25
245 0.27
246 0.3
247 0.3
248 0.34
249 0.35