Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NAS4

Protein Details
Accession C0NAS4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
47-67GYVRRFWQQRDHKPTNSKPSTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.333, cyto 11, nucl 8.5, cyto_mito 7.999, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006840  ChaC  
IPR013024  GGCT-like  
IPR036568  GGCT-like_sf  
Gene Ontology GO:0003839  F:gamma-glutamylcyclotransferase activity  
GO:0061928  F:glutathione specific gamma-glutamylcyclotransferase activity  
GO:0006751  P:glutathione catabolic process  
Pfam View protein in Pfam  
PF04752  ChaC  
CDD cd06661  GGCT_like  
Amino Acid Sequences MPHSAIPAPSSWKSHFPNGDLWVFGYGSLIWKPPPHYDQRVLGYIEGYVRRFWQQRDHKPTNSKPSTVWGAAYHIPASHAEEVHAYLDDREVDGYTVHFTPFYAAPSATTTTNDNSSSTANNDTSQTPPITCMVYIGLPTNTQFLRNPADRDPDNIARVISQSCGQSGENREYLYLLEKALEGPEFSRGVNGNGDGIGIGGVADSHVADLARRVRAIEGKDVSEVDRKRSEIVLEHLPGPELGREERPVRMEEFEGGDVDCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.45
4 0.49
5 0.48
6 0.47
7 0.39
8 0.35
9 0.28
10 0.24
11 0.21
12 0.15
13 0.11
14 0.12
15 0.12
16 0.13
17 0.12
18 0.16
19 0.19
20 0.25
21 0.31
22 0.37
23 0.43
24 0.47
25 0.52
26 0.53
27 0.54
28 0.48
29 0.43
30 0.35
31 0.28
32 0.27
33 0.23
34 0.2
35 0.16
36 0.17
37 0.22
38 0.26
39 0.28
40 0.34
41 0.42
42 0.52
43 0.62
44 0.67
45 0.69
46 0.75
47 0.8
48 0.81
49 0.75
50 0.65
51 0.56
52 0.54
53 0.52
54 0.43
55 0.36
56 0.26
57 0.26
58 0.26
59 0.26
60 0.2
61 0.15
62 0.15
63 0.14
64 0.17
65 0.15
66 0.13
67 0.12
68 0.12
69 0.13
70 0.13
71 0.12
72 0.09
73 0.07
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.07
87 0.09
88 0.09
89 0.1
90 0.09
91 0.09
92 0.1
93 0.12
94 0.13
95 0.12
96 0.12
97 0.12
98 0.12
99 0.15
100 0.14
101 0.13
102 0.12
103 0.13
104 0.13
105 0.13
106 0.14
107 0.12
108 0.12
109 0.14
110 0.14
111 0.14
112 0.15
113 0.14
114 0.11
115 0.12
116 0.12
117 0.11
118 0.09
119 0.08
120 0.07
121 0.07
122 0.07
123 0.08
124 0.07
125 0.07
126 0.07
127 0.09
128 0.09
129 0.1
130 0.1
131 0.11
132 0.16
133 0.18
134 0.21
135 0.21
136 0.26
137 0.25
138 0.28
139 0.31
140 0.29
141 0.28
142 0.26
143 0.23
144 0.18
145 0.19
146 0.16
147 0.12
148 0.1
149 0.1
150 0.1
151 0.11
152 0.11
153 0.15
154 0.18
155 0.21
156 0.2
157 0.2
158 0.2
159 0.18
160 0.18
161 0.17
162 0.14
163 0.1
164 0.09
165 0.09
166 0.09
167 0.1
168 0.09
169 0.07
170 0.07
171 0.1
172 0.1
173 0.1
174 0.12
175 0.12
176 0.13
177 0.14
178 0.14
179 0.11
180 0.1
181 0.11
182 0.08
183 0.07
184 0.05
185 0.04
186 0.03
187 0.02
188 0.02
189 0.02
190 0.03
191 0.03
192 0.03
193 0.04
194 0.04
195 0.04
196 0.09
197 0.13
198 0.15
199 0.15
200 0.16
201 0.18
202 0.23
203 0.26
204 0.3
205 0.29
206 0.28
207 0.29
208 0.3
209 0.29
210 0.32
211 0.31
212 0.29
213 0.3
214 0.3
215 0.31
216 0.32
217 0.32
218 0.28
219 0.32
220 0.33
221 0.31
222 0.32
223 0.3
224 0.29
225 0.27
226 0.23
227 0.2
228 0.16
229 0.16
230 0.18
231 0.23
232 0.25
233 0.29
234 0.31
235 0.31
236 0.31
237 0.32
238 0.3
239 0.28
240 0.29
241 0.26
242 0.24