Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7IIC6

Protein Details
Accession A0A1J7IIC6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-22KILRRVRMAERQVVRRRKKLBasic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008991  Translation_prot_SH3-like_sf  
Amino Acid Sequences MDKILRRVRMAERQVVRRRKKLATTEFLDEVKRKFIRDSKDMHEDVVLSLHQARRARREDWELGPIAPRREAPRVADGSLKETVQWGTIGSARALSNLALSPKGLEERCAWAGGSEYLCLAEGDRVVITEGAMKGRLDKISSIHLETGMVRLEEAKTNITLPPWFTGMGSVAAVPLRVPISAVRLVHPIEDEETGVTKDVIIKELKPIRIMPDRPTRTVTWSRMVPGLNITIPWPRIEKPKVEDNACDTLRIDVEERTFIPTLLSPPMPADVINELRNQYSKFRTRHTEEYIAKKAAEEEEKRAKREQAKEMLTPVQEFNRMQREIRRARGQPVLTEEMLAKIGEVMAKNLNGRGERTVPSIPAETAGGKGADAPLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.8
4 0.79
5 0.79
6 0.78
7 0.79
8 0.79
9 0.79
10 0.77
11 0.73
12 0.71
13 0.67
14 0.6
15 0.56
16 0.49
17 0.41
18 0.4
19 0.37
20 0.33
21 0.36
22 0.41
23 0.45
24 0.48
25 0.53
26 0.51
27 0.58
28 0.57
29 0.51
30 0.45
31 0.38
32 0.31
33 0.27
34 0.2
35 0.12
36 0.16
37 0.17
38 0.21
39 0.25
40 0.29
41 0.36
42 0.41
43 0.42
44 0.44
45 0.51
46 0.52
47 0.51
48 0.52
49 0.45
50 0.4
51 0.44
52 0.41
53 0.35
54 0.3
55 0.3
56 0.29
57 0.33
58 0.35
59 0.33
60 0.37
61 0.38
62 0.38
63 0.39
64 0.35
65 0.33
66 0.32
67 0.28
68 0.2
69 0.19
70 0.18
71 0.14
72 0.13
73 0.1
74 0.09
75 0.12
76 0.13
77 0.11
78 0.14
79 0.13
80 0.13
81 0.13
82 0.12
83 0.1
84 0.11
85 0.12
86 0.1
87 0.1
88 0.1
89 0.1
90 0.15
91 0.14
92 0.15
93 0.15
94 0.21
95 0.22
96 0.22
97 0.2
98 0.16
99 0.17
100 0.17
101 0.15
102 0.1
103 0.09
104 0.08
105 0.09
106 0.09
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.08
117 0.09
118 0.09
119 0.1
120 0.1
121 0.11
122 0.13
123 0.14
124 0.12
125 0.13
126 0.13
127 0.18
128 0.2
129 0.19
130 0.17
131 0.17
132 0.16
133 0.15
134 0.15
135 0.1
136 0.09
137 0.07
138 0.08
139 0.08
140 0.1
141 0.1
142 0.1
143 0.09
144 0.11
145 0.11
146 0.11
147 0.11
148 0.1
149 0.11
150 0.11
151 0.1
152 0.09
153 0.09
154 0.09
155 0.09
156 0.08
157 0.07
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.04
165 0.05
166 0.05
167 0.08
168 0.11
169 0.12
170 0.12
171 0.14
172 0.14
173 0.14
174 0.13
175 0.11
176 0.09
177 0.09
178 0.08
179 0.06
180 0.07
181 0.07
182 0.07
183 0.06
184 0.05
185 0.07
186 0.07
187 0.1
188 0.1
189 0.1
190 0.16
191 0.21
192 0.22
193 0.21
194 0.21
195 0.24
196 0.31
197 0.33
198 0.33
199 0.39
200 0.41
201 0.42
202 0.45
203 0.41
204 0.4
205 0.45
206 0.42
207 0.36
208 0.33
209 0.33
210 0.32
211 0.32
212 0.25
213 0.2
214 0.18
215 0.14
216 0.13
217 0.12
218 0.12
219 0.12
220 0.13
221 0.14
222 0.14
223 0.23
224 0.25
225 0.29
226 0.3
227 0.38
228 0.42
229 0.42
230 0.42
231 0.39
232 0.43
233 0.38
234 0.35
235 0.27
236 0.23
237 0.21
238 0.2
239 0.16
240 0.11
241 0.12
242 0.13
243 0.13
244 0.16
245 0.16
246 0.15
247 0.14
248 0.13
249 0.14
250 0.16
251 0.16
252 0.12
253 0.12
254 0.13
255 0.13
256 0.12
257 0.11
258 0.12
259 0.15
260 0.17
261 0.18
262 0.18
263 0.19
264 0.22
265 0.22
266 0.23
267 0.28
268 0.35
269 0.36
270 0.41
271 0.49
272 0.53
273 0.59
274 0.61
275 0.63
276 0.6
277 0.65
278 0.65
279 0.59
280 0.52
281 0.44
282 0.39
283 0.34
284 0.37
285 0.31
286 0.32
287 0.42
288 0.46
289 0.48
290 0.5
291 0.53
292 0.53
293 0.59
294 0.6
295 0.59
296 0.6
297 0.59
298 0.59
299 0.57
300 0.5
301 0.43
302 0.37
303 0.3
304 0.3
305 0.28
306 0.3
307 0.33
308 0.34
309 0.34
310 0.4
311 0.47
312 0.51
313 0.59
314 0.62
315 0.57
316 0.61
317 0.67
318 0.61
319 0.55
320 0.54
321 0.51
322 0.41
323 0.39
324 0.33
325 0.26
326 0.25
327 0.21
328 0.14
329 0.08
330 0.09
331 0.11
332 0.11
333 0.12
334 0.14
335 0.17
336 0.18
337 0.2
338 0.24
339 0.23
340 0.25
341 0.28
342 0.29
343 0.29
344 0.33
345 0.33
346 0.3
347 0.32
348 0.32
349 0.27
350 0.24
351 0.24
352 0.19
353 0.18
354 0.18
355 0.15
356 0.12
357 0.13