Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7I9G1

Protein Details
Accession A0A1J7I9G1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-75LLSQKQNKKTKENKKKTQKKNTKKKKRKNFGTPHKSQQKGBasic
NLS Segment(s)
PositionSequence
38-98SQKQNKKTKENKKKTQKKNTKKKKRKNFGTPHKSQQKGGGTTRVRPPKTHREGGHGDEKGK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MELGNSKTPGRFQGQAAPKRARQSGRSGTSLLRPGLLSQKQNKKTKENKKKTQKKNTKKKKRKNFGTPHKSQQKGGGTTRVRPPKTHREGGHGDEKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.54
4 0.55
5 0.54
6 0.56
7 0.59
8 0.55
9 0.48
10 0.51
11 0.53
12 0.52
13 0.51
14 0.47
15 0.43
16 0.42
17 0.43
18 0.33
19 0.25
20 0.2
21 0.19
22 0.25
23 0.27
24 0.27
25 0.32
26 0.42
27 0.49
28 0.57
29 0.59
30 0.61
31 0.68
32 0.74
33 0.77
34 0.78
35 0.8
36 0.84
37 0.9
38 0.92
39 0.93
40 0.93
41 0.92
42 0.93
43 0.94
44 0.94
45 0.95
46 0.95
47 0.95
48 0.95
49 0.94
50 0.94
51 0.94
52 0.94
53 0.93
54 0.88
55 0.88
56 0.86
57 0.78
58 0.68
59 0.65
60 0.61
61 0.57
62 0.54
63 0.53
64 0.46
65 0.49
66 0.57
67 0.59
68 0.53
69 0.53
70 0.58
71 0.59
72 0.65
73 0.69
74 0.62
75 0.6
76 0.65
77 0.66
78 0.67