Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7IV40

Protein Details
Accession A0A1J7IV40    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-88CYTHLGRTARRRHRLRRSSRMWAVRDHydrophilic
NLS Segment(s)
PositionSequence
72-79RRRHRLRR
Subcellular Location(s) cyto 7, nucl 6, cyto_mito 6, mito 5, plas 5
Family & Domain DBs
Amino Acid Sequences MISCEDTTILLLCASMLPASSLSSIVRRSNFIVWQNIHCVHYLDVLSCGSLHMLDGACIVCLCYTHLGRTARRRHRLRRSSRMWAVRDVRTANHGSELERRDTRKGGVGDATMRNQQSRYLVQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.05
5 0.06
6 0.07
7 0.07
8 0.08
9 0.09
10 0.12
11 0.15
12 0.18
13 0.19
14 0.21
15 0.23
16 0.25
17 0.3
18 0.3
19 0.34
20 0.32
21 0.33
22 0.36
23 0.35
24 0.32
25 0.28
26 0.25
27 0.19
28 0.19
29 0.17
30 0.12
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.07
51 0.07
52 0.08
53 0.14
54 0.17
55 0.22
56 0.31
57 0.4
58 0.47
59 0.57
60 0.65
61 0.69
62 0.77
63 0.83
64 0.84
65 0.85
66 0.82
67 0.82
68 0.82
69 0.8
70 0.71
71 0.69
72 0.64
73 0.57
74 0.54
75 0.46
76 0.38
77 0.35
78 0.34
79 0.26
80 0.25
81 0.23
82 0.21
83 0.26
84 0.29
85 0.3
86 0.33
87 0.35
88 0.35
89 0.37
90 0.37
91 0.37
92 0.35
93 0.32
94 0.3
95 0.3
96 0.32
97 0.33
98 0.35
99 0.32
100 0.32
101 0.31
102 0.29
103 0.3
104 0.3