Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NIS2

Protein Details
Accession C0NIS2    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
5-36IEKVKQEYEEKMKRKKQKSKDVKDGDDKRDKKBasic
NLS Segment(s)
PositionSequence
15-39KMKRKKQKSKDVKDGDDKRDKKKDA
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MDKEIEKVKQEYEEKMKRKKQKSKDVKDGDDKRDKKKDAGEGEDEKAEKEKDDKIKSIQDSAAETRTDGGPRIFSLHKNFYQMRIDRMRNMEIAKRNRERLKNPNFFPSTPKTDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.72
4 0.74
5 0.82
6 0.85
7 0.85
8 0.86
9 0.89
10 0.9
11 0.91
12 0.9
13 0.87
14 0.87
15 0.85
16 0.82
17 0.81
18 0.75
19 0.73
20 0.73
21 0.67
22 0.61
23 0.59
24 0.58
25 0.53
26 0.54
27 0.51
28 0.46
29 0.45
30 0.43
31 0.37
32 0.29
33 0.25
34 0.2
35 0.14
36 0.13
37 0.17
38 0.23
39 0.26
40 0.28
41 0.29
42 0.34
43 0.35
44 0.35
45 0.3
46 0.23
47 0.23
48 0.22
49 0.21
50 0.15
51 0.14
52 0.13
53 0.13
54 0.13
55 0.11
56 0.1
57 0.09
58 0.09
59 0.13
60 0.14
61 0.16
62 0.22
63 0.27
64 0.28
65 0.33
66 0.33
67 0.34
68 0.41
69 0.39
70 0.4
71 0.42
72 0.43
73 0.43
74 0.46
75 0.44
76 0.39
77 0.4
78 0.4
79 0.4
80 0.46
81 0.51
82 0.53
83 0.6
84 0.66
85 0.71
86 0.73
87 0.74
88 0.78
89 0.78
90 0.75
91 0.76
92 0.72
93 0.65
94 0.64
95 0.61