Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7JBM9

Protein Details
Accession A0A1J7JBM9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-62QCEHCRSSRQSRSAHNRCDCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences MTVLVSGNKYACESCVRGHRVSKCQHVNRPLQQINNRGRPISQCEHCRSSRQSRSAHNRCDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.28
3 0.32
4 0.33
5 0.4
6 0.44
7 0.48
8 0.52
9 0.57
10 0.58
11 0.6
12 0.64
13 0.64
14 0.66
15 0.64
16 0.67
17 0.61
18 0.57
19 0.55
20 0.56
21 0.56
22 0.57
23 0.52
24 0.43
25 0.42
26 0.39
27 0.41
28 0.4
29 0.39
30 0.38
31 0.43
32 0.49
33 0.5
34 0.54
35 0.54
36 0.57
37 0.6
38 0.6
39 0.61
40 0.65
41 0.75
42 0.78