Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7IPJ6

Protein Details
Accession A0A1J7IPJ6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-93ILRAVPKKKTSHSKKRHRQMAGKALKDBasic
NLS Segment(s)
PositionSequence
72-86PKKKTSHSKKRHRQM
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LRLASSSSTLLPRLSAATLSSTFRFGAVYTRQLSLPAFPSLLIAVPASIQWSLPSIPSLLEGIWESILRAVPKKKTSHSKKRHRQMAGKALKDVTSLCKCPACGQTKRMHYLCPHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.11
4 0.14
5 0.15
6 0.18
7 0.17
8 0.17
9 0.17
10 0.16
11 0.15
12 0.12
13 0.16
14 0.16
15 0.21
16 0.21
17 0.22
18 0.22
19 0.23
20 0.23
21 0.19
22 0.19
23 0.15
24 0.13
25 0.11
26 0.12
27 0.11
28 0.11
29 0.09
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.06
39 0.06
40 0.06
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.05
53 0.06
54 0.07
55 0.07
56 0.11
57 0.15
58 0.2
59 0.26
60 0.29
61 0.35
62 0.45
63 0.55
64 0.63
65 0.7
66 0.76
67 0.81
68 0.88
69 0.9
70 0.88
71 0.85
72 0.84
73 0.84
74 0.82
75 0.74
76 0.66
77 0.58
78 0.5
79 0.42
80 0.34
81 0.31
82 0.28
83 0.27
84 0.27
85 0.28
86 0.29
87 0.33
88 0.41
89 0.41
90 0.41
91 0.46
92 0.52
93 0.58
94 0.66
95 0.62
96 0.59