Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NDX6

Protein Details
Accession C0NDX6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-40LPKAAKLQRRHPKTRTLRQSPLKPPEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MIVGDRVAGDQPQLPKAAKLQRRHPKTRTLRQSPLKPPEILAFDQRTECQPSLKRKYMARIWQDIRITRHRSSETGFLKPPKARNDSSGRAEAHSLSGWGCRCLLVLLRILSASEHELDFDLGALLPSMRCLWDCVTKPFEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.28
4 0.37
5 0.4
6 0.45
7 0.53
8 0.61
9 0.69
10 0.77
11 0.74
12 0.76
13 0.79
14 0.82
15 0.82
16 0.81
17 0.81
18 0.81
19 0.86
20 0.85
21 0.83
22 0.77
23 0.66
24 0.58
25 0.53
26 0.47
27 0.39
28 0.35
29 0.29
30 0.26
31 0.26
32 0.26
33 0.24
34 0.24
35 0.23
36 0.23
37 0.27
38 0.36
39 0.43
40 0.48
41 0.5
42 0.48
43 0.55
44 0.57
45 0.59
46 0.54
47 0.54
48 0.5
49 0.51
50 0.51
51 0.48
52 0.45
53 0.44
54 0.44
55 0.37
56 0.39
57 0.35
58 0.34
59 0.32
60 0.36
61 0.31
62 0.29
63 0.3
64 0.29
65 0.32
66 0.34
67 0.38
68 0.36
69 0.39
70 0.36
71 0.4
72 0.45
73 0.46
74 0.47
75 0.46
76 0.4
77 0.36
78 0.35
79 0.3
80 0.23
81 0.18
82 0.14
83 0.09
84 0.12
85 0.12
86 0.12
87 0.11
88 0.1
89 0.1
90 0.11
91 0.12
92 0.11
93 0.14
94 0.14
95 0.14
96 0.14
97 0.14
98 0.14
99 0.13
100 0.12
101 0.1
102 0.09
103 0.09
104 0.1
105 0.1
106 0.1
107 0.08
108 0.07
109 0.06
110 0.06
111 0.06
112 0.05
113 0.05
114 0.06
115 0.07
116 0.08
117 0.08
118 0.11
119 0.15
120 0.23
121 0.27
122 0.32