Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7IBG6

Protein Details
Accession A0A1J7IBG6    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-105PARGQTASPRNRQRPKHFPNFPQLRSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, cyto_nucl 7, pero 6, nucl 4.5, plas 4, mito 3
Family & Domain DBs
Amino Acid Sequences MDGSGSPEKGPPIPPSIPPDWSPPPPEGPLICLSIKQITTTAAHGRFSIHSPGLPGLPARFLAAVVWLRLSAAFPLPCLPARGQTASPRNRQRPKHFPNFPQLRSEPIRRRTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.37
4 0.38
5 0.37
6 0.4
7 0.39
8 0.41
9 0.39
10 0.35
11 0.36
12 0.34
13 0.35
14 0.28
15 0.26
16 0.24
17 0.24
18 0.22
19 0.19
20 0.18
21 0.18
22 0.18
23 0.15
24 0.14
25 0.12
26 0.13
27 0.15
28 0.19
29 0.17
30 0.18
31 0.17
32 0.18
33 0.18
34 0.19
35 0.19
36 0.14
37 0.13
38 0.13
39 0.13
40 0.12
41 0.11
42 0.09
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.05
49 0.05
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.05
59 0.08
60 0.08
61 0.08
62 0.1
63 0.12
64 0.12
65 0.14
66 0.14
67 0.16
68 0.19
69 0.22
70 0.23
71 0.3
72 0.39
73 0.43
74 0.52
75 0.58
76 0.65
77 0.71
78 0.78
79 0.8
80 0.82
81 0.84
82 0.86
83 0.85
84 0.81
85 0.83
86 0.83
87 0.76
88 0.73
89 0.65
90 0.62
91 0.6
92 0.63
93 0.62