Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NWE8

Protein Details
Accession C0NWE8   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-61QHNWHCLTRLKKRNRTRENNSVKKARHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MSEKVPEEGARKRYISNVKYEYNVLITEKNEGITSQHNWHCLTRLKKRNRTRENNSVKKARPHQEIRVDTRSIASLNTKRAVVNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.47
4 0.48
5 0.45
6 0.46
7 0.46
8 0.39
9 0.31
10 0.29
11 0.21
12 0.17
13 0.15
14 0.16
15 0.15
16 0.14
17 0.13
18 0.12
19 0.12
20 0.13
21 0.16
22 0.19
23 0.21
24 0.22
25 0.24
26 0.24
27 0.26
28 0.29
29 0.33
30 0.37
31 0.45
32 0.53
33 0.61
34 0.71
35 0.78
36 0.82
37 0.85
38 0.84
39 0.85
40 0.86
41 0.86
42 0.83
43 0.8
44 0.73
45 0.72
46 0.73
47 0.7
48 0.68
49 0.65
50 0.67
51 0.69
52 0.72
53 0.71
54 0.67
55 0.6
56 0.51
57 0.46
58 0.39
59 0.29
60 0.24
61 0.25
62 0.25
63 0.29
64 0.32
65 0.31