Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7JI67

Protein Details
Accession A0A1J7JI67    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
159-180AGNCKPWVRYLPKRPRRGSSAEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 7, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001568  RNase_T2-like  
IPR036430  RNase_T2-like_sf  
IPR033130  RNase_T2_His_AS_2  
Gene Ontology GO:0033897  F:ribonuclease T2 activity  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00445  Ribonuclease_T2  
PROSITE View protein in PROSITE  
PS00531  RNASE_T2_2  
Amino Acid Sequences MTPTYPNITATLLHHNQTSLLTFMSRYWTAAWGTAPHLWAHEYNKHGTCINTLSPPCYGASYVPGLEVVDYFTRAADLFRTLDTYTALAARNIVPSRDERYPLADVKQALEEYSGGRVVLRCSGRGDVLHEAWYVYFVRGSLQSGEFVPAKTLGREGGAGNCKPWVRYLPKRPRRGSSAEGDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.25
4 0.24
5 0.23
6 0.14
7 0.12
8 0.11
9 0.11
10 0.12
11 0.17
12 0.16
13 0.15
14 0.15
15 0.17
16 0.17
17 0.19
18 0.19
19 0.15
20 0.18
21 0.19
22 0.18
23 0.16
24 0.16
25 0.16
26 0.18
27 0.21
28 0.23
29 0.24
30 0.29
31 0.3
32 0.31
33 0.31
34 0.28
35 0.26
36 0.24
37 0.23
38 0.24
39 0.22
40 0.22
41 0.21
42 0.21
43 0.19
44 0.17
45 0.15
46 0.1
47 0.12
48 0.12
49 0.11
50 0.1
51 0.1
52 0.09
53 0.09
54 0.08
55 0.07
56 0.06
57 0.07
58 0.07
59 0.06
60 0.07
61 0.07
62 0.07
63 0.06
64 0.07
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.09
72 0.08
73 0.09
74 0.09
75 0.07
76 0.08
77 0.08
78 0.1
79 0.1
80 0.1
81 0.1
82 0.11
83 0.16
84 0.17
85 0.18
86 0.15
87 0.19
88 0.21
89 0.22
90 0.22
91 0.2
92 0.19
93 0.18
94 0.19
95 0.15
96 0.12
97 0.12
98 0.1
99 0.08
100 0.09
101 0.08
102 0.06
103 0.07
104 0.07
105 0.08
106 0.13
107 0.13
108 0.13
109 0.15
110 0.16
111 0.17
112 0.17
113 0.2
114 0.18
115 0.18
116 0.19
117 0.17
118 0.16
119 0.14
120 0.15
121 0.13
122 0.09
123 0.08
124 0.07
125 0.08
126 0.09
127 0.11
128 0.12
129 0.12
130 0.13
131 0.13
132 0.16
133 0.16
134 0.15
135 0.15
136 0.15
137 0.15
138 0.15
139 0.15
140 0.13
141 0.13
142 0.14
143 0.14
144 0.19
145 0.24
146 0.24
147 0.24
148 0.28
149 0.27
150 0.27
151 0.29
152 0.3
153 0.33
154 0.43
155 0.54
156 0.61
157 0.7
158 0.8
159 0.83
160 0.83
161 0.81
162 0.78
163 0.73
164 0.71