Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J7J8V7

Protein Details
Accession A0A1J7J8V7   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
11-59DVNAPKRNKLKTGPKPKPKPNPLLVDPAAYVPPPRKKPKIRYTNEQIIEHydrophilic
NLS Segment(s)
PositionSequence
14-31APKRNKLKTGPKPKPKPN
44-49PRKKPK
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MPNRGPRKILDVNAPKRNKLKTGPKPKPKPNPLLVDPAAYVPPPRKKPKIRYTNEQIIEVLQFLYYHRILEKKPDGRIGEKLARYRSGTILQKSPELFQAPEGHRYRSPTYEEAADWFQIPKSTVSTWWNTKLEMIGIKPEVVPRAPMPDFLLHRPPAAGQPAQPAEPIPGAVPIANGLPAANPVQAPDTMQGVVSTAQGAVPAAGPQVAAPVDGQPDVIAQPETADGSPAIKNQPASDSSEQGAAEVAGRASNSPADDTPTPTPSEQLADVANFNEEVSDLNKEMDSSEDDEEEEDEDEVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.67
4 0.68
5 0.64
6 0.63
7 0.65
8 0.66
9 0.74
10 0.79
11 0.83
12 0.89
13 0.92
14 0.94
15 0.92
16 0.91
17 0.88
18 0.86
19 0.79
20 0.78
21 0.68
22 0.59
23 0.5
24 0.42
25 0.34
26 0.25
27 0.24
28 0.22
29 0.3
30 0.37
31 0.45
32 0.54
33 0.63
34 0.74
35 0.82
36 0.85
37 0.84
38 0.85
39 0.86
40 0.86
41 0.78
42 0.69
43 0.58
44 0.48
45 0.41
46 0.31
47 0.21
48 0.11
49 0.09
50 0.08
51 0.12
52 0.11
53 0.11
54 0.13
55 0.16
56 0.17
57 0.26
58 0.35
59 0.36
60 0.39
61 0.44
62 0.46
63 0.45
64 0.49
65 0.47
66 0.45
67 0.44
68 0.46
69 0.42
70 0.42
71 0.41
72 0.39
73 0.35
74 0.34
75 0.37
76 0.35
77 0.37
78 0.35
79 0.36
80 0.35
81 0.33
82 0.29
83 0.24
84 0.21
85 0.19
86 0.26
87 0.24
88 0.32
89 0.33
90 0.33
91 0.32
92 0.37
93 0.37
94 0.33
95 0.35
96 0.28
97 0.28
98 0.27
99 0.25
100 0.23
101 0.22
102 0.19
103 0.15
104 0.13
105 0.12
106 0.11
107 0.12
108 0.1
109 0.11
110 0.11
111 0.13
112 0.16
113 0.2
114 0.23
115 0.28
116 0.27
117 0.25
118 0.25
119 0.22
120 0.21
121 0.18
122 0.15
123 0.11
124 0.11
125 0.11
126 0.11
127 0.11
128 0.11
129 0.1
130 0.11
131 0.09
132 0.14
133 0.13
134 0.14
135 0.15
136 0.17
137 0.19
138 0.2
139 0.25
140 0.19
141 0.19
142 0.19
143 0.18
144 0.16
145 0.17
146 0.16
147 0.11
148 0.16
149 0.17
150 0.17
151 0.16
152 0.14
153 0.13
154 0.12
155 0.12
156 0.07
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.05
168 0.06
169 0.06
170 0.06
171 0.06
172 0.08
173 0.08
174 0.09
175 0.08
176 0.09
177 0.09
178 0.09
179 0.08
180 0.08
181 0.08
182 0.07
183 0.07
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.06
196 0.05
197 0.05
198 0.05
199 0.06
200 0.07
201 0.08
202 0.08
203 0.06
204 0.07
205 0.07
206 0.08
207 0.07
208 0.06
209 0.06
210 0.07
211 0.08
212 0.08
213 0.08
214 0.07
215 0.09
216 0.11
217 0.12
218 0.14
219 0.15
220 0.15
221 0.15
222 0.19
223 0.18
224 0.25
225 0.25
226 0.26
227 0.24
228 0.27
229 0.25
230 0.22
231 0.2
232 0.13
233 0.11
234 0.09
235 0.09
236 0.06
237 0.07
238 0.07
239 0.08
240 0.1
241 0.1
242 0.12
243 0.12
244 0.17
245 0.18
246 0.23
247 0.26
248 0.26
249 0.28
250 0.26
251 0.27
252 0.23
253 0.24
254 0.2
255 0.18
256 0.17
257 0.15
258 0.16
259 0.15
260 0.15
261 0.12
262 0.11
263 0.1
264 0.08
265 0.08
266 0.09
267 0.12
268 0.12
269 0.13
270 0.14
271 0.14
272 0.14
273 0.15
274 0.16
275 0.16
276 0.17
277 0.17
278 0.17
279 0.18
280 0.18
281 0.16
282 0.14