Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7J0Q2

Protein Details
Accession A0A1J7J0Q2    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-64HKTFKTKQKLAKAQKQNRPIPQHydrophilic
68-90LRTNNTIRYNAKRRNWRKTRLGLHydrophilic
NLS Segment(s)
PositionSequence
80-81RR
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MLYIFWFSVGYSEERLNTGTRQPAALARVTPRLKSARSSNASHKTFKTKQKLAKAQKQNRPIPQWIRLRTNNTIRYNAKRRNWRKTRLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.17
5 0.2
6 0.22
7 0.21
8 0.21
9 0.21
10 0.23
11 0.23
12 0.23
13 0.2
14 0.18
15 0.26
16 0.26
17 0.26
18 0.27
19 0.29
20 0.28
21 0.31
22 0.34
23 0.34
24 0.38
25 0.41
26 0.45
27 0.51
28 0.53
29 0.51
30 0.47
31 0.47
32 0.49
33 0.54
34 0.54
35 0.52
36 0.56
37 0.63
38 0.72
39 0.72
40 0.75
41 0.78
42 0.79
43 0.8
44 0.83
45 0.8
46 0.77
47 0.74
48 0.72
49 0.66
50 0.66
51 0.66
52 0.63
53 0.63
54 0.62
55 0.62
56 0.63
57 0.66
58 0.67
59 0.62
60 0.64
61 0.62
62 0.66
63 0.69
64 0.71
65 0.7
66 0.73
67 0.78
68 0.81
69 0.86
70 0.86