Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J7JJ75

Protein Details
Accession A0A1J7JJ75    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
268-295KDLTVRIEQKKQRNKNTKQTRIVKKTVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR037231  NAP-like_sf  
IPR002164  NAP_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0006334  P:nucleosome assembly  
Pfam View protein in Pfam  
PF00956  NAP  
Amino Acid Sequences MAEPIRNKRPDTQTAPTPQNTPASNAPISSHAQQPGVASIMEEGDFDRTAAASIFAQNPKLVSLIQGRLGSLVGRSSGYIESLSPPIKKRVAGLKGIQKEHSKLEAQFQEEVLQLEKKYFEKFTPLYQKRAAIINGAAEPTENEVKAGEEDEEPEESGAEDATNDESSEPKVDGPGVPEFWLSAMKNQISLAEMITDRDEGALKSLTDIRMEYLDKPGFRLIFEFAENEYFTNKTITKTYYYQNESGYGGDFIYDHAEGDKIDWKAGKDLTVRIEQKKQRNKNTKQTRIVKKTVPTESFFNFFSPPKAPTEEDDDDAASDIEERLELDYQLGEDIKEKLIPRAIDWFTGEALAYEELEEDDFEGEFDEEDDEDDDDLSEDHDDEEESEEDDEDGTKPKQEAAECKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.66
4 0.61
5 0.55
6 0.53
7 0.47
8 0.43
9 0.39
10 0.38
11 0.36
12 0.34
13 0.32
14 0.3
15 0.32
16 0.3
17 0.31
18 0.27
19 0.27
20 0.27
21 0.27
22 0.25
23 0.22
24 0.19
25 0.14
26 0.12
27 0.12
28 0.11
29 0.1
30 0.09
31 0.1
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.09
38 0.09
39 0.08
40 0.11
41 0.17
42 0.18
43 0.2
44 0.2
45 0.2
46 0.19
47 0.19
48 0.16
49 0.14
50 0.19
51 0.2
52 0.24
53 0.24
54 0.24
55 0.23
56 0.23
57 0.2
58 0.14
59 0.12
60 0.09
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.1
67 0.1
68 0.12
69 0.16
70 0.19
71 0.2
72 0.23
73 0.28
74 0.3
75 0.3
76 0.33
77 0.38
78 0.41
79 0.43
80 0.47
81 0.5
82 0.55
83 0.57
84 0.56
85 0.5
86 0.48
87 0.45
88 0.42
89 0.37
90 0.31
91 0.37
92 0.36
93 0.35
94 0.34
95 0.3
96 0.28
97 0.25
98 0.25
99 0.19
100 0.16
101 0.14
102 0.14
103 0.16
104 0.15
105 0.17
106 0.18
107 0.17
108 0.22
109 0.24
110 0.31
111 0.4
112 0.42
113 0.45
114 0.46
115 0.48
116 0.42
117 0.45
118 0.36
119 0.27
120 0.25
121 0.21
122 0.19
123 0.17
124 0.15
125 0.1
126 0.1
127 0.11
128 0.12
129 0.1
130 0.09
131 0.09
132 0.1
133 0.1
134 0.11
135 0.09
136 0.07
137 0.09
138 0.1
139 0.1
140 0.1
141 0.09
142 0.08
143 0.07
144 0.07
145 0.05
146 0.04
147 0.03
148 0.04
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.07
155 0.08
156 0.08
157 0.07
158 0.07
159 0.08
160 0.08
161 0.1
162 0.12
163 0.11
164 0.11
165 0.11
166 0.1
167 0.1
168 0.12
169 0.1
170 0.1
171 0.13
172 0.12
173 0.13
174 0.13
175 0.13
176 0.11
177 0.11
178 0.09
179 0.07
180 0.07
181 0.07
182 0.08
183 0.07
184 0.06
185 0.06
186 0.07
187 0.05
188 0.07
189 0.07
190 0.06
191 0.07
192 0.1
193 0.1
194 0.1
195 0.1
196 0.09
197 0.1
198 0.12
199 0.11
200 0.15
201 0.17
202 0.16
203 0.17
204 0.19
205 0.17
206 0.16
207 0.16
208 0.12
209 0.12
210 0.12
211 0.12
212 0.1
213 0.12
214 0.12
215 0.11
216 0.1
217 0.09
218 0.09
219 0.11
220 0.11
221 0.11
222 0.13
223 0.15
224 0.18
225 0.21
226 0.24
227 0.29
228 0.32
229 0.33
230 0.31
231 0.31
232 0.28
233 0.25
234 0.22
235 0.15
236 0.11
237 0.09
238 0.08
239 0.06
240 0.07
241 0.07
242 0.06
243 0.06
244 0.07
245 0.06
246 0.08
247 0.13
248 0.11
249 0.12
250 0.14
251 0.14
252 0.18
253 0.18
254 0.21
255 0.18
256 0.2
257 0.23
258 0.29
259 0.33
260 0.34
261 0.42
262 0.46
263 0.54
264 0.61
265 0.67
266 0.7
267 0.77
268 0.82
269 0.84
270 0.88
271 0.88
272 0.88
273 0.89
274 0.89
275 0.86
276 0.83
277 0.78
278 0.73
279 0.71
280 0.69
281 0.62
282 0.54
283 0.5
284 0.46
285 0.43
286 0.37
287 0.3
288 0.25
289 0.22
290 0.22
291 0.21
292 0.2
293 0.21
294 0.24
295 0.24
296 0.24
297 0.32
298 0.31
299 0.3
300 0.29
301 0.26
302 0.22
303 0.22
304 0.19
305 0.1
306 0.08
307 0.07
308 0.06
309 0.06
310 0.06
311 0.07
312 0.08
313 0.08
314 0.08
315 0.08
316 0.08
317 0.09
318 0.09
319 0.08
320 0.09
321 0.11
322 0.11
323 0.14
324 0.15
325 0.18
326 0.22
327 0.23
328 0.22
329 0.29
330 0.3
331 0.28
332 0.29
333 0.27
334 0.22
335 0.22
336 0.2
337 0.12
338 0.12
339 0.1
340 0.09
341 0.08
342 0.08
343 0.07
344 0.08
345 0.08
346 0.06
347 0.07
348 0.06
349 0.06
350 0.07
351 0.07
352 0.07
353 0.07
354 0.08
355 0.07
356 0.08
357 0.09
358 0.09
359 0.09
360 0.09
361 0.09
362 0.08
363 0.08
364 0.08
365 0.08
366 0.07
367 0.07
368 0.08
369 0.08
370 0.08
371 0.12
372 0.12
373 0.12
374 0.12
375 0.12
376 0.12
377 0.12
378 0.12
379 0.1
380 0.14
381 0.14
382 0.17
383 0.18
384 0.21
385 0.26
386 0.3
387 0.38