Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L0DEA2

Protein Details
Accession A0A1L0DEA2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-105DFTPHRSPRSVRKKRPNFDDLFHydrophilic
NLS Segment(s)
PositionSequence
32-47KPPKTPAKTPAKKGIR
Subcellular Location(s) nucl 20, mito_nucl 13.666, cyto_nucl 12.166, mito 5
Family & Domain DBs
Amino Acid Sequences MLDIPHTPPSASQARNQNRTAQGPIPHFQLPKPPKTPAKTPAKKGIRTPSSKSHNSQLKTPNTGKLNKVLFGEKSSMLFPPTPDFTPHRSPRSVRKKRPNFDDLFALSTHMEMGMFLPNHASVGSGRKLASPMKSLKAPLALDLSELSQINENLTFEEDPYDDSIMLSPTKLPRRKKQALLNTPGGQLITDEKVKMWHGDSYHSGFSSDEESEFGAPGPKLINPFVTSTEPPAKKVKNPFNNTTEIDYSTHNEFINHRTGERKVEALLESQRKFKPKKIDFSGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.59
4 0.61
5 0.58
6 0.6
7 0.59
8 0.54
9 0.51
10 0.49
11 0.5
12 0.46
13 0.45
14 0.42
15 0.37
16 0.42
17 0.43
18 0.46
19 0.48
20 0.52
21 0.56
22 0.61
23 0.68
24 0.67
25 0.71
26 0.71
27 0.74
28 0.76
29 0.77
30 0.75
31 0.75
32 0.76
33 0.74
34 0.71
35 0.7
36 0.69
37 0.69
38 0.7
39 0.66
40 0.65
41 0.63
42 0.59
43 0.61
44 0.6
45 0.58
46 0.59
47 0.59
48 0.56
49 0.54
50 0.57
51 0.51
52 0.5
53 0.46
54 0.41
55 0.4
56 0.36
57 0.32
58 0.29
59 0.3
60 0.23
61 0.22
62 0.2
63 0.19
64 0.17
65 0.17
66 0.15
67 0.16
68 0.18
69 0.18
70 0.21
71 0.24
72 0.27
73 0.37
74 0.42
75 0.43
76 0.45
77 0.47
78 0.55
79 0.63
80 0.68
81 0.68
82 0.73
83 0.78
84 0.82
85 0.87
86 0.85
87 0.77
88 0.69
89 0.64
90 0.54
91 0.45
92 0.37
93 0.3
94 0.21
95 0.16
96 0.14
97 0.08
98 0.06
99 0.04
100 0.05
101 0.08
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.05
110 0.09
111 0.11
112 0.12
113 0.12
114 0.12
115 0.15
116 0.16
117 0.18
118 0.18
119 0.2
120 0.21
121 0.22
122 0.22
123 0.21
124 0.22
125 0.2
126 0.17
127 0.15
128 0.13
129 0.12
130 0.11
131 0.11
132 0.09
133 0.09
134 0.08
135 0.07
136 0.07
137 0.08
138 0.08
139 0.07
140 0.06
141 0.08
142 0.08
143 0.06
144 0.08
145 0.07
146 0.08
147 0.08
148 0.09
149 0.07
150 0.07
151 0.08
152 0.07
153 0.07
154 0.07
155 0.08
156 0.13
157 0.22
158 0.29
159 0.35
160 0.43
161 0.53
162 0.61
163 0.66
164 0.7
165 0.73
166 0.75
167 0.75
168 0.73
169 0.64
170 0.57
171 0.5
172 0.4
173 0.29
174 0.2
175 0.16
176 0.12
177 0.11
178 0.1
179 0.1
180 0.12
181 0.13
182 0.15
183 0.14
184 0.14
185 0.14
186 0.18
187 0.21
188 0.23
189 0.23
190 0.22
191 0.21
192 0.18
193 0.18
194 0.17
195 0.15
196 0.11
197 0.1
198 0.11
199 0.11
200 0.11
201 0.1
202 0.11
203 0.1
204 0.1
205 0.11
206 0.11
207 0.14
208 0.14
209 0.17
210 0.15
211 0.17
212 0.2
213 0.23
214 0.22
215 0.26
216 0.35
217 0.33
218 0.34
219 0.41
220 0.41
221 0.44
222 0.54
223 0.58
224 0.59
225 0.66
226 0.71
227 0.67
228 0.69
229 0.65
230 0.6
231 0.52
232 0.43
233 0.37
234 0.32
235 0.3
236 0.27
237 0.27
238 0.22
239 0.21
240 0.21
241 0.24
242 0.3
243 0.28
244 0.26
245 0.29
246 0.31
247 0.37
248 0.37
249 0.35
250 0.27
251 0.3
252 0.3
253 0.3
254 0.36
255 0.38
256 0.38
257 0.43
258 0.47
259 0.52
260 0.55
261 0.58
262 0.6
263 0.6
264 0.69