Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0BFH4

Protein Details
Accession A0A1L0BFH4    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MRRREEEKKRRREEEKKRRRQCGEEDIDBasic
30-52EECLKLKNTKWKLRKCSHSGIKIHydrophilic
NLS Segment(s)
PositionSequence
3-20RREEEKKRRREEEKKRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MRRREEEKKRRREEEKKRRRQCGEEDIDGEECLKLKNTKWKLRKCSHSGIKIFEMKWIISSYPDLSIPGFSKKKQNESCCLKFPPLSKINEEYQNLEISLKMNPRQIGPISGISATSVILFGSHLDSLGPNFVLWSQLYSLAQLCAMSAITLPFSSNYFGIPSLTSGGTLRIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.92
4 0.93
5 0.93
6 0.9
7 0.87
8 0.84
9 0.84
10 0.8
11 0.73
12 0.65
13 0.57
14 0.51
15 0.43
16 0.34
17 0.23
18 0.16
19 0.12
20 0.13
21 0.13
22 0.16
23 0.27
24 0.36
25 0.46
26 0.55
27 0.64
28 0.71
29 0.78
30 0.84
31 0.8
32 0.82
33 0.8
34 0.79
35 0.73
36 0.67
37 0.63
38 0.59
39 0.51
40 0.44
41 0.37
42 0.28
43 0.26
44 0.22
45 0.17
46 0.13
47 0.15
48 0.12
49 0.12
50 0.12
51 0.11
52 0.1
53 0.11
54 0.11
55 0.17
56 0.18
57 0.19
58 0.27
59 0.3
60 0.39
61 0.45
62 0.49
63 0.51
64 0.58
65 0.6
66 0.57
67 0.56
68 0.47
69 0.43
70 0.4
71 0.39
72 0.35
73 0.33
74 0.31
75 0.32
76 0.34
77 0.36
78 0.35
79 0.29
80 0.25
81 0.23
82 0.21
83 0.18
84 0.15
85 0.1
86 0.12
87 0.12
88 0.13
89 0.16
90 0.17
91 0.17
92 0.2
93 0.2
94 0.19
95 0.18
96 0.17
97 0.15
98 0.15
99 0.14
100 0.11
101 0.11
102 0.09
103 0.06
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.06
110 0.06
111 0.05
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.06
118 0.06
119 0.06
120 0.08
121 0.08
122 0.09
123 0.08
124 0.11
125 0.11
126 0.12
127 0.12
128 0.11
129 0.11
130 0.1
131 0.09
132 0.07
133 0.07
134 0.06
135 0.06
136 0.06
137 0.07
138 0.07
139 0.08
140 0.08
141 0.09
142 0.11
143 0.11
144 0.11
145 0.12
146 0.12
147 0.13
148 0.12
149 0.13
150 0.13
151 0.13
152 0.13
153 0.12