Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0BW17

Protein Details
Accession A0A1L0BW17    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-112YRECSKDFFAKKRQDRREGKKGWGIBasic
NLS Segment(s)
PositionSequence
99-108KRQDRREGKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSDKTNNERILSDKAVTDKEKVNFTEGEVEEYKFYPDNPKNHRHKYRWANKEASRYYDPCEESRQASINCVLRNQKDKSVCQEFFDAYRECSKDFFAKKRQDRREGKKGWGIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.32
4 0.31
5 0.31
6 0.31
7 0.35
8 0.34
9 0.34
10 0.29
11 0.28
12 0.34
13 0.27
14 0.29
15 0.26
16 0.25
17 0.23
18 0.23
19 0.23
20 0.15
21 0.15
22 0.2
23 0.24
24 0.32
25 0.38
26 0.48
27 0.55
28 0.65
29 0.74
30 0.69
31 0.73
32 0.76
33 0.79
34 0.78
35 0.75
36 0.73
37 0.68
38 0.73
39 0.64
40 0.59
41 0.52
42 0.44
43 0.41
44 0.39
45 0.36
46 0.28
47 0.3
48 0.26
49 0.24
50 0.24
51 0.26
52 0.2
53 0.2
54 0.23
55 0.23
56 0.22
57 0.24
58 0.26
59 0.26
60 0.33
61 0.34
62 0.37
63 0.38
64 0.4
65 0.45
66 0.5
67 0.47
68 0.42
69 0.42
70 0.36
71 0.33
72 0.35
73 0.28
74 0.21
75 0.26
76 0.25
77 0.23
78 0.23
79 0.25
80 0.28
81 0.34
82 0.4
83 0.44
84 0.54
85 0.63
86 0.73
87 0.8
88 0.82
89 0.86
90 0.88
91 0.89
92 0.84
93 0.82