Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L0DMK3

Protein Details
Accession A0A1L0DMK3   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
117-137FKNKVYKDADRTRKSRRKTKNBasic
NLS Segment(s)
PositionSequence
127-137RTRKSRRKTKN
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, mito_nucl 11.166, cyto 6
Family & Domain DBs
Amino Acid Sequences MFKSYFPSGWFRKAADAPPATTTDSSSFTMPGRDNSLLLKVSMKESTEEFVAIDYKKMSYAEVAQMSKNKKQTSKVPLAVPKSHRINENQYEILANEDEDLTESLYTEKVKTNNYFFKNKVYKDADRTRKSRRKTKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.41
4 0.36
5 0.36
6 0.37
7 0.33
8 0.29
9 0.27
10 0.21
11 0.22
12 0.21
13 0.19
14 0.18
15 0.17
16 0.2
17 0.19
18 0.19
19 0.21
20 0.2
21 0.2
22 0.2
23 0.23
24 0.19
25 0.18
26 0.18
27 0.14
28 0.16
29 0.16
30 0.16
31 0.14
32 0.14
33 0.15
34 0.13
35 0.12
36 0.1
37 0.09
38 0.11
39 0.1
40 0.09
41 0.09
42 0.08
43 0.09
44 0.09
45 0.09
46 0.07
47 0.09
48 0.12
49 0.15
50 0.15
51 0.16
52 0.2
53 0.23
54 0.26
55 0.29
56 0.28
57 0.28
58 0.31
59 0.38
60 0.42
61 0.47
62 0.48
63 0.48
64 0.51
65 0.52
66 0.54
67 0.49
68 0.48
69 0.45
70 0.43
71 0.41
72 0.39
73 0.43
74 0.43
75 0.44
76 0.37
77 0.32
78 0.31
79 0.28
80 0.26
81 0.18
82 0.12
83 0.08
84 0.07
85 0.07
86 0.08
87 0.08
88 0.07
89 0.06
90 0.07
91 0.07
92 0.08
93 0.09
94 0.09
95 0.13
96 0.16
97 0.22
98 0.26
99 0.34
100 0.41
101 0.46
102 0.51
103 0.49
104 0.56
105 0.59
106 0.56
107 0.58
108 0.56
109 0.58
110 0.61
111 0.7
112 0.7
113 0.7
114 0.75
115 0.77
116 0.79
117 0.82