Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0DRZ8

Protein Details
Accession A0A1L0DRZ8    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSLRSKPKLRAKSVKRNGEFAHydrophilic
65-87STSGPRTRNGRISKKKNKKNTTNHydrophilic
NLS Segment(s)
PositionSequence
6-39RSKPKLRAKSVKRNGEFAKLNEARNARLAEKLKA
53-83DKDKEKVEKKKISTSGPRTRNGRISKKKNKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKPKLRAKSVKRNGEFAKLNEARNARLAEKLKANLDKQKEDKMEDEDKDKEKVEKKKISTSGPRTRNGRISKKKNKKNTTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.89
4 0.8
5 0.79
6 0.72
7 0.69
8 0.63
9 0.53
10 0.54
11 0.47
12 0.45
13 0.42
14 0.41
15 0.33
16 0.33
17 0.34
18 0.24
19 0.26
20 0.28
21 0.25
22 0.28
23 0.29
24 0.28
25 0.31
26 0.32
27 0.32
28 0.33
29 0.35
30 0.34
31 0.38
32 0.36
33 0.34
34 0.33
35 0.33
36 0.35
37 0.3
38 0.32
39 0.3
40 0.31
41 0.31
42 0.3
43 0.3
44 0.32
45 0.4
46 0.46
47 0.49
48 0.52
49 0.59
50 0.63
51 0.66
52 0.68
53 0.7
54 0.7
55 0.69
56 0.71
57 0.67
58 0.68
59 0.68
60 0.68
61 0.69
62 0.7
63 0.74
64 0.79
65 0.86
66 0.9
67 0.92