Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0BSI1

Protein Details
Accession A0A1L0BSI1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
174-193QKCFMNRYKVEKKPKCFICNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR039971  CWC24-like  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF13923  zf-C3HC4_2  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
PS50089  ZF_RING_2  
Amino Acid Sequences MFKKRNIKVASKRRAEADSDGENDQLSLMPSKEVSFKKVKIKPNREATHNEGKNANEEEKNRIKAEDDIDNITVAKLSGPKVPKNIRVTTLTDFQPDVCKDFQQTGYCGYGDTCKFLHIRDELKQKKPIDKEWETVDKKPKDKSEDTLKPFKCPICKEKYRQPVKTQCDHIFCQKCFMNRYKVEKKPKCFICNVDTGGLVQPLLKREREELEKSNED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.61
3 0.55
4 0.5
5 0.45
6 0.4
7 0.38
8 0.33
9 0.3
10 0.26
11 0.21
12 0.15
13 0.11
14 0.1
15 0.09
16 0.1
17 0.11
18 0.12
19 0.19
20 0.2
21 0.25
22 0.3
23 0.35
24 0.44
25 0.51
26 0.6
27 0.64
28 0.71
29 0.75
30 0.79
31 0.78
32 0.73
33 0.73
34 0.7
35 0.7
36 0.63
37 0.56
38 0.48
39 0.43
40 0.43
41 0.39
42 0.36
43 0.29
44 0.29
45 0.34
46 0.38
47 0.41
48 0.37
49 0.34
50 0.32
51 0.31
52 0.32
53 0.3
54 0.25
55 0.24
56 0.23
57 0.23
58 0.21
59 0.18
60 0.14
61 0.09
62 0.08
63 0.07
64 0.08
65 0.13
66 0.16
67 0.19
68 0.27
69 0.31
70 0.38
71 0.42
72 0.43
73 0.42
74 0.41
75 0.43
76 0.38
77 0.38
78 0.31
79 0.26
80 0.24
81 0.21
82 0.23
83 0.19
84 0.19
85 0.15
86 0.15
87 0.14
88 0.16
89 0.19
90 0.16
91 0.16
92 0.16
93 0.16
94 0.16
95 0.15
96 0.13
97 0.14
98 0.12
99 0.13
100 0.11
101 0.12
102 0.12
103 0.12
104 0.16
105 0.15
106 0.17
107 0.22
108 0.32
109 0.37
110 0.42
111 0.49
112 0.48
113 0.52
114 0.53
115 0.54
116 0.52
117 0.5
118 0.47
119 0.46
120 0.53
121 0.5
122 0.51
123 0.54
124 0.5
125 0.5
126 0.53
127 0.53
128 0.51
129 0.51
130 0.52
131 0.53
132 0.57
133 0.59
134 0.63
135 0.58
136 0.54
137 0.55
138 0.52
139 0.48
140 0.45
141 0.47
142 0.47
143 0.55
144 0.58
145 0.65
146 0.72
147 0.75
148 0.76
149 0.77
150 0.77
151 0.76
152 0.77
153 0.75
154 0.71
155 0.66
156 0.63
157 0.63
158 0.61
159 0.54
160 0.53
161 0.48
162 0.46
163 0.47
164 0.5
165 0.49
166 0.49
167 0.58
168 0.62
169 0.68
170 0.75
171 0.78
172 0.79
173 0.8
174 0.81
175 0.78
176 0.73
177 0.7
178 0.64
179 0.63
180 0.58
181 0.5
182 0.41
183 0.36
184 0.32
185 0.27
186 0.21
187 0.15
188 0.15
189 0.19
190 0.22
191 0.23
192 0.24
193 0.27
194 0.35
195 0.4
196 0.44
197 0.46