Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0BHF9

Protein Details
Accession A0A1L0BHF9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-101KEAYRVKMVADRKKRNKGAPKKKSSBasic
NLS Segment(s)
PositionSequence
87-101DRKKRNKGAPKKKSS
Subcellular Location(s) mito 13, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSILKKINLRQLKEVKQLLALIFGETYNPQNVRNGAKVLRAPLKGPEVVSWYGVNDAAPTFKDFKEWFPELRLVDPKEAYRVKMVADRKKRNKGAPKKKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.57
3 0.51
4 0.49
5 0.39
6 0.33
7 0.26
8 0.17
9 0.14
10 0.13
11 0.12
12 0.11
13 0.12
14 0.12
15 0.13
16 0.13
17 0.16
18 0.18
19 0.21
20 0.22
21 0.23
22 0.21
23 0.24
24 0.24
25 0.26
26 0.29
27 0.26
28 0.25
29 0.25
30 0.26
31 0.24
32 0.23
33 0.19
34 0.17
35 0.17
36 0.17
37 0.14
38 0.11
39 0.11
40 0.1
41 0.09
42 0.06
43 0.06
44 0.05
45 0.06
46 0.08
47 0.1
48 0.09
49 0.14
50 0.14
51 0.17
52 0.24
53 0.25
54 0.25
55 0.25
56 0.3
57 0.27
58 0.3
59 0.34
60 0.29
61 0.3
62 0.3
63 0.28
64 0.32
65 0.32
66 0.29
67 0.27
68 0.25
69 0.24
70 0.29
71 0.37
72 0.4
73 0.49
74 0.58
75 0.65
76 0.75
77 0.81
78 0.84
79 0.86
80 0.88
81 0.88