Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0G1T0

Protein Details
Accession A0A1L0G1T0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-74ATDGEDKLKKRRKRRQYDDLPKEEPBasic
NLS Segment(s)
PositionSequence
47-64KKRATDGEDKLKKRRKRR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSDTEKPVAEKKVEEKVEEKVEDSKPVEKKASEDVEKAEEKTEGSEKKRATDGEDKLKKRRKRRQYDDLPKEEPESEDGEDDTKDDNRLEQEWDDDEEEDMLEIDESNIITGRRTRGKVIDFKKAAEELKKENKEVNSEDEEDYDEQAPKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.4
4 0.45
5 0.41
6 0.38
7 0.35
8 0.34
9 0.37
10 0.37
11 0.38
12 0.35
13 0.39
14 0.41
15 0.35
16 0.36
17 0.38
18 0.44
19 0.39
20 0.37
21 0.35
22 0.36
23 0.37
24 0.35
25 0.28
26 0.21
27 0.18
28 0.19
29 0.23
30 0.23
31 0.25
32 0.31
33 0.3
34 0.32
35 0.36
36 0.33
37 0.33
38 0.36
39 0.38
40 0.43
41 0.51
42 0.52
43 0.58
44 0.67
45 0.68
46 0.7
47 0.75
48 0.75
49 0.78
50 0.84
51 0.85
52 0.88
53 0.92
54 0.9
55 0.86
56 0.78
57 0.67
58 0.59
59 0.49
60 0.37
61 0.28
62 0.2
63 0.14
64 0.12
65 0.11
66 0.1
67 0.1
68 0.1
69 0.09
70 0.08
71 0.08
72 0.08
73 0.09
74 0.1
75 0.11
76 0.12
77 0.11
78 0.12
79 0.13
80 0.14
81 0.14
82 0.13
83 0.12
84 0.1
85 0.1
86 0.08
87 0.07
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.07
98 0.1
99 0.15
100 0.21
101 0.23
102 0.26
103 0.31
104 0.38
105 0.46
106 0.48
107 0.54
108 0.49
109 0.48
110 0.48
111 0.46
112 0.43
113 0.4
114 0.4
115 0.38
116 0.47
117 0.5
118 0.48
119 0.5
120 0.49
121 0.49
122 0.48
123 0.46
124 0.41
125 0.4
126 0.39
127 0.34
128 0.34
129 0.29
130 0.28
131 0.24