Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NHD8

Protein Details
Accession C0NHD8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
172-193SDWPYPKPWRKASKTNTDRRMPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016740  F:transferase activity  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
Amino Acid Sequences MLAKARDEYNVKLKPISPLQASPDVTWGDSFTKLLAFNLTEYERILIFDSDSTILQSMDELFLLPSAPVAMPRAYWLQSEDNFLTSGLVVLEPSEFQFSRIINAISEKDLKEYDMELMNRLYQNHCLILPHRPYFLISGEFRGDNHSRYLGSDNEVWDPQKVFAEAKIIHFSDWPYPKPWRKASKTNTDRRMPNCSIGLTGEEDCRGRDIWLSLYEDFRERRKVEPPSVIHSCGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.46
4 0.4
5 0.38
6 0.42
7 0.47
8 0.47
9 0.41
10 0.39
11 0.33
12 0.3
13 0.27
14 0.23
15 0.17
16 0.16
17 0.16
18 0.12
19 0.13
20 0.13
21 0.13
22 0.13
23 0.12
24 0.12
25 0.15
26 0.16
27 0.15
28 0.15
29 0.15
30 0.13
31 0.13
32 0.14
33 0.1
34 0.1
35 0.1
36 0.11
37 0.11
38 0.11
39 0.1
40 0.09
41 0.09
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.06
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.07
57 0.07
58 0.07
59 0.09
60 0.12
61 0.12
62 0.13
63 0.15
64 0.17
65 0.18
66 0.23
67 0.21
68 0.19
69 0.19
70 0.18
71 0.15
72 0.11
73 0.1
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.07
82 0.07
83 0.08
84 0.1
85 0.1
86 0.12
87 0.13
88 0.13
89 0.1
90 0.12
91 0.12
92 0.12
93 0.14
94 0.12
95 0.12
96 0.12
97 0.12
98 0.11
99 0.11
100 0.1
101 0.12
102 0.12
103 0.11
104 0.12
105 0.13
106 0.13
107 0.13
108 0.13
109 0.11
110 0.12
111 0.12
112 0.12
113 0.11
114 0.12
115 0.18
116 0.22
117 0.21
118 0.21
119 0.2
120 0.21
121 0.22
122 0.22
123 0.19
124 0.14
125 0.15
126 0.16
127 0.16
128 0.15
129 0.19
130 0.19
131 0.16
132 0.17
133 0.16
134 0.15
135 0.16
136 0.19
137 0.14
138 0.16
139 0.16
140 0.16
141 0.17
142 0.18
143 0.17
144 0.16
145 0.16
146 0.14
147 0.14
148 0.13
149 0.12
150 0.11
151 0.17
152 0.17
153 0.19
154 0.22
155 0.21
156 0.2
157 0.21
158 0.22
159 0.24
160 0.27
161 0.26
162 0.26
163 0.35
164 0.42
165 0.5
166 0.58
167 0.6
168 0.63
169 0.72
170 0.76
171 0.78
172 0.81
173 0.83
174 0.82
175 0.8
176 0.79
177 0.73
178 0.73
179 0.65
180 0.6
181 0.52
182 0.44
183 0.37
184 0.31
185 0.29
186 0.23
187 0.21
188 0.18
189 0.17
190 0.17
191 0.16
192 0.17
193 0.16
194 0.14
195 0.15
196 0.15
197 0.17
198 0.21
199 0.24
200 0.23
201 0.25
202 0.26
203 0.29
204 0.3
205 0.31
206 0.36
207 0.34
208 0.37
209 0.43
210 0.5
211 0.53
212 0.59
213 0.59
214 0.59
215 0.62