Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L0C4C6

Protein Details
Accession A0A1L0C4C6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
93-124LLETKTEKEKPKRKVIKKSPRQNDRFRRRMLVBasic
NLS Segment(s)
PositionSequence
98-120TEKEKPKRKVIKKSPRQNDRFRR
Subcellular Location(s) cyto 8.5, cyto_nucl 7.5, mito 7, nucl 5.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MANKPLVRTISADEVRSHASPDDLWMVVYNKVYDVSKFATLHPGGVEVLVDCGGVDATEAFEDVGHSQDAFDMLLPYLVGELPSNERKKYAHLLETKTEKEKPKRKVIKKSPRQNDRFRRRMLVSALVTLAIFSLLVVVVLQKLQWLKLTTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.31
4 0.28
5 0.19
6 0.18
7 0.16
8 0.17
9 0.18
10 0.14
11 0.14
12 0.15
13 0.16
14 0.16
15 0.17
16 0.15
17 0.12
18 0.14
19 0.14
20 0.12
21 0.14
22 0.15
23 0.19
24 0.19
25 0.19
26 0.25
27 0.24
28 0.25
29 0.22
30 0.2
31 0.15
32 0.14
33 0.13
34 0.06
35 0.06
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.04
67 0.03
68 0.04
69 0.08
70 0.14
71 0.17
72 0.17
73 0.18
74 0.18
75 0.22
76 0.28
77 0.28
78 0.29
79 0.33
80 0.37
81 0.41
82 0.46
83 0.45
84 0.42
85 0.43
86 0.44
87 0.49
88 0.54
89 0.56
90 0.62
91 0.7
92 0.76
93 0.82
94 0.85
95 0.86
96 0.89
97 0.92
98 0.91
99 0.91
100 0.9
101 0.9
102 0.9
103 0.89
104 0.87
105 0.8
106 0.77
107 0.69
108 0.67
109 0.6
110 0.57
111 0.48
112 0.41
113 0.37
114 0.3
115 0.26
116 0.2
117 0.16
118 0.07
119 0.06
120 0.04
121 0.04
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.05
128 0.05
129 0.08
130 0.09
131 0.11
132 0.16