Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L0D443

Protein Details
Accession A0A1L0D443    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-42YLWKKAPRLSPPQKQRLRNRMKLVDRNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 13.833, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKSSLVAYGGYLWKKAPRLSPPQKQRLRNRMKLVDRNIEILYQSLKPKDSISTGYKKIDYLKFDFPKESEMIPRDKYTTFDKKVKDYRKSVHLVPKWTKKSFRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.22
5 0.25
6 0.28
7 0.31
8 0.34
9 0.44
10 0.53
11 0.62
12 0.68
13 0.75
14 0.8
15 0.83
16 0.86
17 0.86
18 0.86
19 0.84
20 0.83
21 0.82
22 0.82
23 0.81
24 0.76
25 0.73
26 0.64
27 0.58
28 0.5
29 0.41
30 0.32
31 0.24
32 0.2
33 0.14
34 0.15
35 0.13
36 0.13
37 0.14
38 0.14
39 0.15
40 0.15
41 0.17
42 0.2
43 0.24
44 0.26
45 0.28
46 0.27
47 0.27
48 0.3
49 0.29
50 0.28
51 0.27
52 0.34
53 0.35
54 0.36
55 0.37
56 0.32
57 0.31
58 0.29
59 0.25
60 0.21
61 0.21
62 0.24
63 0.25
64 0.26
65 0.25
66 0.24
67 0.26
68 0.29
69 0.36
70 0.38
71 0.42
72 0.44
73 0.5
74 0.6
75 0.66
76 0.67
77 0.65
78 0.65
79 0.67
80 0.69
81 0.67
82 0.67
83 0.63
84 0.64
85 0.66
86 0.71
87 0.7
88 0.72
89 0.74
90 0.7
91 0.75
92 0.76
93 0.78