Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0D775

Protein Details
Accession A0A1L0D775    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-64AKFDEKKDYDRRCNKKHPAAKKSTPCLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, mito_nucl 13.499, cyto_mito 9.999, nucl 8.5, cyto_nucl 6.166
Family & Domain DBs
Amino Acid Sequences MPFLSKKKSTSSTLSMSSSSTAASASSLNSCHNKSYAKFDEKKDYDRRCNKKHPAAKKSTPCLVSFCVGKKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.34
4 0.3
5 0.24
6 0.18
7 0.13
8 0.09
9 0.07
10 0.07
11 0.07
12 0.06
13 0.07
14 0.08
15 0.1
16 0.13
17 0.14
18 0.14
19 0.16
20 0.18
21 0.18
22 0.26
23 0.3
24 0.34
25 0.38
26 0.41
27 0.49
28 0.49
29 0.55
30 0.56
31 0.58
32 0.61
33 0.66
34 0.73
35 0.71
36 0.79
37 0.81
38 0.82
39 0.83
40 0.83
41 0.83
42 0.84
43 0.85
44 0.84
45 0.82
46 0.79
47 0.72
48 0.63
49 0.57
50 0.51
51 0.44
52 0.39