Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0BP30

Protein Details
Accession A0A1L0BP30    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
193-221LQQSEFKVVTRRKRNRPKKHVYVEPKLDYHydrophilic
NLS Segment(s)
PositionSequence
203-211RRKRNRPKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MASLENVQKRLASHVETIQSTEFLEQSLKLLRQLPFKNIRCIALGSPTQEFQALYQLALLKLLAKEFDIPPANISLYDPIFTDDDVHLLTTFEKYVVDENEQTSPQYTSETLYYMPHAPRSVTDRFLANVKPNWILGNDVRVTAGSLSQAKFLEEYPRLAKLVHIAEVRHTDAKEASTNVSTDSMASPRTPGLQQSEFKVVTRRKRNRPKKHVYVEPKLDYDLVDVYFDTITVTRIDSPDSAPWNDSFSDLALNVINPIEPNRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.34
4 0.35
5 0.3
6 0.27
7 0.24
8 0.21
9 0.16
10 0.12
11 0.12
12 0.1
13 0.12
14 0.17
15 0.17
16 0.18
17 0.24
18 0.27
19 0.35
20 0.38
21 0.45
22 0.5
23 0.53
24 0.59
25 0.56
26 0.54
27 0.47
28 0.46
29 0.39
30 0.35
31 0.33
32 0.27
33 0.26
34 0.25
35 0.23
36 0.21
37 0.2
38 0.14
39 0.18
40 0.16
41 0.14
42 0.15
43 0.16
44 0.15
45 0.15
46 0.14
47 0.1
48 0.1
49 0.1
50 0.09
51 0.08
52 0.11
53 0.11
54 0.18
55 0.18
56 0.18
57 0.19
58 0.2
59 0.19
60 0.17
61 0.17
62 0.14
63 0.11
64 0.11
65 0.11
66 0.11
67 0.11
68 0.11
69 0.12
70 0.09
71 0.1
72 0.09
73 0.1
74 0.08
75 0.08
76 0.08
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.09
83 0.1
84 0.13
85 0.13
86 0.14
87 0.16
88 0.16
89 0.16
90 0.15
91 0.14
92 0.11
93 0.11
94 0.1
95 0.09
96 0.1
97 0.1
98 0.1
99 0.09
100 0.11
101 0.13
102 0.13
103 0.14
104 0.14
105 0.13
106 0.14
107 0.19
108 0.19
109 0.17
110 0.18
111 0.17
112 0.17
113 0.19
114 0.19
115 0.17
116 0.17
117 0.17
118 0.17
119 0.16
120 0.16
121 0.14
122 0.15
123 0.12
124 0.14
125 0.13
126 0.12
127 0.12
128 0.11
129 0.11
130 0.09
131 0.09
132 0.06
133 0.08
134 0.08
135 0.11
136 0.11
137 0.11
138 0.11
139 0.11
140 0.16
141 0.14
142 0.17
143 0.16
144 0.18
145 0.18
146 0.17
147 0.17
148 0.16
149 0.16
150 0.18
151 0.17
152 0.16
153 0.18
154 0.21
155 0.23
156 0.21
157 0.19
158 0.16
159 0.16
160 0.18
161 0.17
162 0.16
163 0.15
164 0.14
165 0.14
166 0.14
167 0.14
168 0.12
169 0.11
170 0.11
171 0.1
172 0.1
173 0.1
174 0.1
175 0.1
176 0.13
177 0.12
178 0.14
179 0.19
180 0.24
181 0.25
182 0.28
183 0.33
184 0.31
185 0.32
186 0.38
187 0.38
188 0.42
189 0.52
190 0.59
191 0.64
192 0.74
193 0.85
194 0.88
195 0.92
196 0.93
197 0.93
198 0.92
199 0.92
200 0.9
201 0.89
202 0.86
203 0.8
204 0.7
205 0.6
206 0.51
207 0.41
208 0.33
209 0.25
210 0.16
211 0.13
212 0.11
213 0.11
214 0.1
215 0.1
216 0.09
217 0.08
218 0.08
219 0.08
220 0.1
221 0.11
222 0.12
223 0.14
224 0.14
225 0.17
226 0.22
227 0.25
228 0.25
229 0.25
230 0.25
231 0.26
232 0.25
233 0.23
234 0.19
235 0.15
236 0.15
237 0.13
238 0.14
239 0.12
240 0.11
241 0.11
242 0.11
243 0.11
244 0.09