Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L0BLN9

Protein Details
Accession A0A1L0BLN9   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-73LPLIRTKKFLQQKKREKIHEQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, cyto 11.5, nucl 10.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR018060  HTH_AraC  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00165  HTH_AraC  
PROSITE View protein in PROSITE  
PS01124  HTH_ARAC_FAMILY_2  
Amino Acid Sequences MAQQDQKFDVDKVAANVGLSKWHFCRVFKNYTGYTPRKFYLQSRGGKITPQPLPLIRTKKFLQQKKREKIHEQIESLLRSLPDSLFNSENEGGDLVVGGDKAIVDDKFGGVNMIGKFGGSLEEMKRLQGILRLGEMIYLGEIIRLEDTTRIRHLQARIHLEVIHWGARYSEDYVGEQGTQGVYKPTLRPRQAIKTQAGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.18
4 0.16
5 0.2
6 0.19
7 0.21
8 0.2
9 0.27
10 0.3
11 0.3
12 0.39
13 0.39
14 0.46
15 0.46
16 0.51
17 0.46
18 0.51
19 0.59
20 0.56
21 0.54
22 0.5
23 0.47
24 0.44
25 0.44
26 0.41
27 0.42
28 0.44
29 0.47
30 0.48
31 0.53
32 0.49
33 0.5
34 0.48
35 0.45
36 0.4
37 0.35
38 0.32
39 0.29
40 0.33
41 0.37
42 0.42
43 0.36
44 0.38
45 0.37
46 0.43
47 0.51
48 0.56
49 0.59
50 0.62
51 0.72
52 0.77
53 0.84
54 0.82
55 0.79
56 0.79
57 0.76
58 0.72
59 0.62
60 0.56
61 0.51
62 0.44
63 0.39
64 0.31
65 0.22
66 0.16
67 0.15
68 0.12
69 0.11
70 0.12
71 0.14
72 0.14
73 0.15
74 0.18
75 0.17
76 0.17
77 0.13
78 0.12
79 0.09
80 0.07
81 0.07
82 0.04
83 0.03
84 0.03
85 0.03
86 0.02
87 0.02
88 0.03
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.09
99 0.08
100 0.09
101 0.09
102 0.08
103 0.08
104 0.08
105 0.09
106 0.05
107 0.08
108 0.07
109 0.13
110 0.13
111 0.13
112 0.13
113 0.13
114 0.13
115 0.14
116 0.15
117 0.11
118 0.11
119 0.12
120 0.11
121 0.11
122 0.11
123 0.07
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.05
132 0.06
133 0.09
134 0.11
135 0.14
136 0.18
137 0.19
138 0.21
139 0.26
140 0.3
141 0.32
142 0.38
143 0.42
144 0.4
145 0.4
146 0.39
147 0.33
148 0.34
149 0.29
150 0.24
151 0.17
152 0.16
153 0.15
154 0.16
155 0.18
156 0.16
157 0.16
158 0.15
159 0.16
160 0.18
161 0.18
162 0.17
163 0.15
164 0.13
165 0.11
166 0.1
167 0.09
168 0.11
169 0.12
170 0.15
171 0.21
172 0.3
173 0.4
174 0.43
175 0.49
176 0.54
177 0.63
178 0.68
179 0.69