Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L0G8P2

Protein Details
Accession A0A1L0G8P2   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-115AVINQRKMMVKKNKSKKSKKKYTQVDEDRQAQPHydrophilic
NLS Segment(s)
PositionSequence
92-103VKKNKSKKSKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MPPRPLWLIKEDEITEEFLKGGRGPGGQKINKSNSKVQLTHKPTGIVVTCQYSRSQELNRKRAREILALKLEELENPDNCRTAVINQRKMMVKKNKSKKSKKKYTQVDEDRQAQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.21
4 0.19
5 0.14
6 0.15
7 0.12
8 0.13
9 0.11
10 0.12
11 0.14
12 0.21
13 0.29
14 0.31
15 0.35
16 0.41
17 0.47
18 0.51
19 0.54
20 0.54
21 0.53
22 0.56
23 0.56
24 0.55
25 0.57
26 0.57
27 0.56
28 0.5
29 0.43
30 0.37
31 0.36
32 0.31
33 0.22
34 0.16
35 0.16
36 0.16
37 0.16
38 0.16
39 0.15
40 0.17
41 0.18
42 0.22
43 0.27
44 0.36
45 0.45
46 0.49
47 0.5
48 0.48
49 0.5
50 0.48
51 0.47
52 0.41
53 0.39
54 0.4
55 0.37
56 0.36
57 0.32
58 0.29
59 0.22
60 0.22
61 0.17
62 0.14
63 0.17
64 0.18
65 0.17
66 0.17
67 0.17
68 0.15
69 0.17
70 0.25
71 0.32
72 0.39
73 0.39
74 0.44
75 0.49
76 0.51
77 0.56
78 0.57
79 0.57
80 0.61
81 0.7
82 0.76
83 0.81
84 0.9
85 0.91
86 0.91
87 0.93
88 0.93
89 0.93
90 0.94
91 0.93
92 0.93
93 0.92
94 0.9
95 0.86