Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0C3D2

Protein Details
Accession A0A1L0C3D2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-88AFKTVKRLGKKIKNVWKPDYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 12.499, cyto 11, cyto_nucl 7.666, cyto_pero 6.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR014436  Extradiol_dOase_DODA  
IPR004183  Xdiol_dOase_suB  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0008198  F:ferrous iron binding  
GO:0016701  F:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen  
GO:0008270  F:zinc ion binding  
GO:0006725  P:cellular aromatic compound metabolic process  
Pfam View protein in Pfam  
PF02900  LigB  
CDD cd07363  45_DOPA_Dioxygenase  
Amino Acid Sequences MILKMATQSTKPLIAETVRSVSSTTGAAAATASAVSSALKPDIPNPNPFPSFFFSHGGPTFMYENDKGAFKTVKRLGKKIKNVWKPDYIVVVSAHWQLTGSKAIEIAIPPARNGGDLEENALVYDFYGFPRHMYKEQFRTMNSRFVSGEIRDRLKKNGFHADLTKRGIDHGVWVPFKVAFSDYNTLKPAPEGVDVGLDLPETSLVQVSLTGNEKDFDTHYKLGEVLSYYRDNLIWDPVREKYLKGMVIVSGMSVHNLRDLGRAMSYGKPMPYAATFNKLLTKTMVNTPDLLDNLNKIKTENGSLLFQAHPTLEHFVPIVVGGGLLKDHPDQQIKEVFNSEELSLGWGIYQFGEDPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.28
4 0.29
5 0.25
6 0.25
7 0.24
8 0.21
9 0.2
10 0.17
11 0.13
12 0.11
13 0.1
14 0.1
15 0.09
16 0.08
17 0.07
18 0.06
19 0.05
20 0.04
21 0.04
22 0.05
23 0.06
24 0.08
25 0.09
26 0.11
27 0.11
28 0.18
29 0.28
30 0.31
31 0.38
32 0.41
33 0.47
34 0.47
35 0.48
36 0.46
37 0.4
38 0.41
39 0.37
40 0.35
41 0.28
42 0.32
43 0.32
44 0.29
45 0.24
46 0.22
47 0.2
48 0.19
49 0.22
50 0.16
51 0.18
52 0.18
53 0.19
54 0.17
55 0.19
56 0.23
57 0.2
58 0.29
59 0.34
60 0.41
61 0.44
62 0.53
63 0.6
64 0.65
65 0.74
66 0.75
67 0.78
68 0.79
69 0.82
70 0.79
71 0.75
72 0.69
73 0.61
74 0.56
75 0.45
76 0.38
77 0.31
78 0.26
79 0.21
80 0.2
81 0.18
82 0.13
83 0.13
84 0.11
85 0.12
86 0.15
87 0.14
88 0.12
89 0.12
90 0.12
91 0.13
92 0.13
93 0.15
94 0.15
95 0.14
96 0.14
97 0.15
98 0.15
99 0.14
100 0.14
101 0.13
102 0.13
103 0.12
104 0.15
105 0.13
106 0.13
107 0.12
108 0.12
109 0.09
110 0.06
111 0.07
112 0.05
113 0.05
114 0.08
115 0.08
116 0.09
117 0.13
118 0.17
119 0.19
120 0.25
121 0.31
122 0.36
123 0.42
124 0.43
125 0.41
126 0.45
127 0.44
128 0.46
129 0.39
130 0.34
131 0.29
132 0.27
133 0.29
134 0.23
135 0.27
136 0.23
137 0.27
138 0.29
139 0.3
140 0.34
141 0.36
142 0.38
143 0.36
144 0.42
145 0.39
146 0.37
147 0.42
148 0.41
149 0.4
150 0.38
151 0.34
152 0.25
153 0.24
154 0.22
155 0.16
156 0.15
157 0.15
158 0.17
159 0.17
160 0.17
161 0.17
162 0.16
163 0.16
164 0.13
165 0.1
166 0.07
167 0.1
168 0.15
169 0.15
170 0.17
171 0.18
172 0.18
173 0.17
174 0.16
175 0.14
176 0.11
177 0.11
178 0.09
179 0.08
180 0.08
181 0.08
182 0.08
183 0.07
184 0.05
185 0.04
186 0.04
187 0.04
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.04
194 0.05
195 0.07
196 0.09
197 0.09
198 0.1
199 0.1
200 0.1
201 0.1
202 0.11
203 0.13
204 0.16
205 0.17
206 0.17
207 0.17
208 0.17
209 0.16
210 0.16
211 0.13
212 0.1
213 0.12
214 0.12
215 0.12
216 0.13
217 0.13
218 0.13
219 0.13
220 0.18
221 0.17
222 0.17
223 0.19
224 0.2
225 0.23
226 0.23
227 0.23
228 0.2
229 0.23
230 0.23
231 0.21
232 0.2
233 0.17
234 0.17
235 0.17
236 0.13
237 0.09
238 0.08
239 0.08
240 0.08
241 0.08
242 0.08
243 0.09
244 0.09
245 0.1
246 0.11
247 0.12
248 0.11
249 0.13
250 0.14
251 0.16
252 0.18
253 0.19
254 0.18
255 0.18
256 0.17
257 0.18
258 0.18
259 0.21
260 0.19
261 0.22
262 0.23
263 0.23
264 0.29
265 0.28
266 0.27
267 0.24
268 0.25
269 0.23
270 0.28
271 0.31
272 0.26
273 0.26
274 0.26
275 0.27
276 0.25
277 0.23
278 0.17
279 0.17
280 0.2
281 0.21
282 0.2
283 0.18
284 0.2
285 0.21
286 0.24
287 0.24
288 0.23
289 0.22
290 0.23
291 0.25
292 0.22
293 0.2
294 0.18
295 0.14
296 0.13
297 0.13
298 0.18
299 0.15
300 0.15
301 0.15
302 0.14
303 0.14
304 0.13
305 0.11
306 0.06
307 0.06
308 0.05
309 0.05
310 0.06
311 0.06
312 0.08
313 0.08
314 0.11
315 0.17
316 0.23
317 0.25
318 0.3
319 0.37
320 0.37
321 0.38
322 0.39
323 0.34
324 0.3
325 0.31
326 0.26
327 0.2
328 0.18
329 0.18
330 0.15
331 0.13
332 0.11
333 0.1
334 0.1
335 0.09
336 0.1
337 0.08