Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L0BKJ1

Protein Details
Accession A0A1L0BKJ1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-172AVVSHGEKKKKQSDKKGLINKVKSIFHydrophilic
NLS Segment(s)
PositionSequence
154-161KKKKQSDK
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MISTGRGGAGNMVLPSDIPKKASPPAEHKHDHKKIYYSTGRGGAGNIKSSDEIPSPKLVPQGSNTPALTTLKFTTGRGGYGNMVSNDDPELARKLQDVDGNKPSESELQAVTSNKSFSVGRGGFGNVISNTRSHGSSTGSGSNNLYAVVSHGEKKKKQSDKKGLINKVKSIFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.13
3 0.16
4 0.16
5 0.17
6 0.18
7 0.22
8 0.28
9 0.35
10 0.37
11 0.42
12 0.49
13 0.54
14 0.59
15 0.62
16 0.67
17 0.68
18 0.66
19 0.62
20 0.6
21 0.55
22 0.59
23 0.58
24 0.51
25 0.47
26 0.46
27 0.43
28 0.37
29 0.34
30 0.31
31 0.26
32 0.26
33 0.22
34 0.19
35 0.18
36 0.19
37 0.2
38 0.16
39 0.17
40 0.15
41 0.18
42 0.18
43 0.19
44 0.22
45 0.2
46 0.19
47 0.2
48 0.24
49 0.24
50 0.27
51 0.25
52 0.22
53 0.23
54 0.22
55 0.2
56 0.16
57 0.14
58 0.14
59 0.15
60 0.15
61 0.17
62 0.16
63 0.17
64 0.15
65 0.16
66 0.13
67 0.13
68 0.15
69 0.11
70 0.12
71 0.11
72 0.11
73 0.1
74 0.1
75 0.08
76 0.08
77 0.1
78 0.08
79 0.09
80 0.09
81 0.1
82 0.12
83 0.15
84 0.17
85 0.2
86 0.25
87 0.26
88 0.26
89 0.24
90 0.23
91 0.22
92 0.2
93 0.16
94 0.11
95 0.11
96 0.14
97 0.15
98 0.16
99 0.14
100 0.14
101 0.12
102 0.14
103 0.12
104 0.1
105 0.19
106 0.17
107 0.17
108 0.18
109 0.19
110 0.17
111 0.17
112 0.2
113 0.11
114 0.12
115 0.12
116 0.11
117 0.13
118 0.14
119 0.14
120 0.12
121 0.14
122 0.16
123 0.18
124 0.21
125 0.25
126 0.25
127 0.26
128 0.25
129 0.25
130 0.21
131 0.19
132 0.15
133 0.09
134 0.09
135 0.11
136 0.12
137 0.17
138 0.24
139 0.32
140 0.36
141 0.44
142 0.53
143 0.6
144 0.69
145 0.75
146 0.79
147 0.82
148 0.88
149 0.9
150 0.9
151 0.9
152 0.85
153 0.81