Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NSL1

Protein Details
Accession C0NSL1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
147-170RVVEAERREKRRQMRKLGERVDELBasic
NLS Segment(s)
PositionSequence
155-158EKRR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR021384  Mediator_Med21  
Gene Ontology GO:0016592  C:mediator complex  
Pfam View protein in Pfam  
PF11221  Med21  
Amino Acid Sequences MADILTQLQTCLDQLATQFYATLCYLTTYHDHAAATPPSNIPTAIPQLKKIPKNPSPTATTSTTAKAASPQPTTPAAADAQAQQQEPSPAEPTPDPPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSEAEQEEKIRRLAEELRVVEAERREKRRQMRKLGERVDELLGAVEGTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.14
4 0.14
5 0.14
6 0.13
7 0.16
8 0.15
9 0.15
10 0.1
11 0.11
12 0.11
13 0.13
14 0.15
15 0.16
16 0.17
17 0.19
18 0.18
19 0.17
20 0.22
21 0.23
22 0.22
23 0.2
24 0.19
25 0.19
26 0.19
27 0.19
28 0.14
29 0.15
30 0.2
31 0.25
32 0.25
33 0.26
34 0.34
35 0.42
36 0.47
37 0.5
38 0.52
39 0.53
40 0.6
41 0.62
42 0.58
43 0.56
44 0.53
45 0.52
46 0.45
47 0.4
48 0.33
49 0.3
50 0.27
51 0.22
52 0.19
53 0.18
54 0.19
55 0.21
56 0.22
57 0.21
58 0.22
59 0.23
60 0.24
61 0.2
62 0.18
63 0.13
64 0.11
65 0.12
66 0.1
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.12
73 0.12
74 0.12
75 0.11
76 0.09
77 0.11
78 0.11
79 0.13
80 0.17
81 0.18
82 0.17
83 0.16
84 0.18
85 0.18
86 0.19
87 0.2
88 0.19
89 0.18
90 0.22
91 0.22
92 0.22
93 0.23
94 0.23
95 0.2
96 0.19
97 0.19
98 0.19
99 0.2
100 0.19
101 0.18
102 0.17
103 0.16
104 0.15
105 0.14
106 0.1
107 0.09
108 0.09
109 0.07
110 0.07
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.07
119 0.08
120 0.08
121 0.09
122 0.11
123 0.16
124 0.18
125 0.18
126 0.17
127 0.17
128 0.2
129 0.25
130 0.29
131 0.31
132 0.3
133 0.31
134 0.31
135 0.32
136 0.32
137 0.33
138 0.35
139 0.36
140 0.42
141 0.46
142 0.54
143 0.64
144 0.71
145 0.75
146 0.77
147 0.8
148 0.83
149 0.87
150 0.87
151 0.82
152 0.75
153 0.68
154 0.59
155 0.48
156 0.38
157 0.28
158 0.2