Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NH33

Protein Details
Accession C0NH33    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-92MSSARRKRRWYGVRIGRRPPDBasic
NLS Segment(s)
PositionSequence
76-99RRKRRWYGVRIGRRPPDPRNARRS
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MCHPHPSRGRTVGSRASYPDDPPRMDPTKKLHIPLSYSTPKPQGDGMTKSDRHEHGRRDHCAQSDIINNHAMSSARRKRRWYGVRIGRRPPDPRNARRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.45
4 0.41
5 0.4
6 0.42
7 0.38
8 0.37
9 0.37
10 0.42
11 0.42
12 0.41
13 0.43
14 0.41
15 0.47
16 0.48
17 0.47
18 0.44
19 0.4
20 0.43
21 0.4
22 0.42
23 0.36
24 0.35
25 0.35
26 0.36
27 0.33
28 0.3
29 0.29
30 0.25
31 0.24
32 0.26
33 0.28
34 0.3
35 0.31
36 0.31
37 0.33
38 0.31
39 0.34
40 0.36
41 0.37
42 0.4
43 0.46
44 0.49
45 0.5
46 0.51
47 0.46
48 0.43
49 0.37
50 0.31
51 0.3
52 0.28
53 0.24
54 0.23
55 0.21
56 0.2
57 0.2
58 0.18
59 0.13
60 0.23
61 0.31
62 0.38
63 0.43
64 0.48
65 0.54
66 0.64
67 0.72
68 0.69
69 0.71
70 0.72
71 0.78
72 0.81
73 0.83
74 0.79
75 0.78
76 0.77
77 0.73
78 0.73
79 0.73