Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L0B8B3

Protein Details
Accession A0A1L0B8B3   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
344-365SSPTKATPFTPRKPRRRSSVAAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.833, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039301  Sip5/DA2  
Amino Acid Sequences MGNVPTKDQRARLLSLNSIGSGSTVGRLTRRNTTLSLIGGSTSHLSNGLFAAAKANSKSEDKMKMREKHCLDLIVRIHENVDGGYLAPYGIYKLNLDYNTEIVRGLVLSRRLAPFYTPLQDFDESWTDDEIATLVRQMPLHALDSAFDDEEEEDDADDHKIHKSLNHFRRQELKRRHQELAAKMKEVQRQYENEYLQCKEASDPDVPSKDLLLRLYRDASECPICFLYFPRNLNYSRCCRQPICTECFVQIKRLDPHPPHDDPSEEKKDELPHTLISEYANCPYCAMSNFGVTYEHPIDLLVGMGASMSAKDYRERQSIDVIPEGEETGGEHAVISSDETSRPSSPTKATPFTPRKPRRRSSVAADAEGVITTDYIRPDWEQKLASAKSKLARKAATASAIHASNLILDEGSGSRESQQQYLMSLEDRMIEEAMRLLILSEEERSRQASKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.43
4 0.35
5 0.3
6 0.26
7 0.2
8 0.16
9 0.13
10 0.11
11 0.12
12 0.13
13 0.17
14 0.22
15 0.26
16 0.33
17 0.36
18 0.37
19 0.37
20 0.4
21 0.4
22 0.36
23 0.34
24 0.25
25 0.22
26 0.19
27 0.18
28 0.16
29 0.13
30 0.11
31 0.1
32 0.1
33 0.1
34 0.11
35 0.11
36 0.09
37 0.09
38 0.13
39 0.13
40 0.16
41 0.16
42 0.18
43 0.19
44 0.21
45 0.25
46 0.28
47 0.37
48 0.39
49 0.48
50 0.55
51 0.61
52 0.62
53 0.68
54 0.66
55 0.63
56 0.61
57 0.58
58 0.49
59 0.48
60 0.49
61 0.45
62 0.42
63 0.35
64 0.32
65 0.26
66 0.26
67 0.17
68 0.15
69 0.08
70 0.07
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.07
77 0.08
78 0.08
79 0.08
80 0.1
81 0.16
82 0.16
83 0.19
84 0.19
85 0.2
86 0.2
87 0.2
88 0.18
89 0.13
90 0.12
91 0.1
92 0.1
93 0.11
94 0.12
95 0.14
96 0.17
97 0.19
98 0.2
99 0.2
100 0.2
101 0.21
102 0.22
103 0.26
104 0.23
105 0.24
106 0.27
107 0.27
108 0.26
109 0.26
110 0.26
111 0.21
112 0.21
113 0.2
114 0.16
115 0.15
116 0.14
117 0.11
118 0.07
119 0.07
120 0.07
121 0.07
122 0.08
123 0.09
124 0.09
125 0.11
126 0.11
127 0.13
128 0.12
129 0.11
130 0.1
131 0.12
132 0.13
133 0.11
134 0.1
135 0.09
136 0.08
137 0.09
138 0.09
139 0.07
140 0.06
141 0.06
142 0.07
143 0.07
144 0.08
145 0.08
146 0.08
147 0.09
148 0.1
149 0.12
150 0.2
151 0.3
152 0.39
153 0.48
154 0.48
155 0.5
156 0.6
157 0.63
158 0.65
159 0.65
160 0.67
161 0.68
162 0.72
163 0.71
164 0.65
165 0.66
166 0.64
167 0.64
168 0.55
169 0.46
170 0.44
171 0.47
172 0.47
173 0.41
174 0.37
175 0.3
176 0.31
177 0.35
178 0.37
179 0.34
180 0.31
181 0.33
182 0.3
183 0.27
184 0.24
185 0.2
186 0.14
187 0.15
188 0.15
189 0.14
190 0.15
191 0.17
192 0.18
193 0.18
194 0.17
195 0.16
196 0.14
197 0.14
198 0.14
199 0.13
200 0.13
201 0.14
202 0.16
203 0.16
204 0.15
205 0.14
206 0.16
207 0.16
208 0.15
209 0.15
210 0.14
211 0.13
212 0.13
213 0.13
214 0.17
215 0.18
216 0.2
217 0.21
218 0.23
219 0.25
220 0.28
221 0.32
222 0.32
223 0.31
224 0.33
225 0.35
226 0.33
227 0.36
228 0.42
229 0.43
230 0.42
231 0.41
232 0.39
233 0.37
234 0.42
235 0.38
236 0.34
237 0.29
238 0.29
239 0.29
240 0.32
241 0.36
242 0.32
243 0.37
244 0.4
245 0.4
246 0.37
247 0.35
248 0.34
249 0.32
250 0.38
251 0.39
252 0.33
253 0.32
254 0.31
255 0.35
256 0.35
257 0.34
258 0.27
259 0.21
260 0.21
261 0.21
262 0.19
263 0.15
264 0.15
265 0.13
266 0.15
267 0.15
268 0.13
269 0.14
270 0.14
271 0.14
272 0.13
273 0.15
274 0.12
275 0.12
276 0.13
277 0.13
278 0.13
279 0.12
280 0.17
281 0.15
282 0.14
283 0.12
284 0.12
285 0.12
286 0.11
287 0.11
288 0.05
289 0.03
290 0.03
291 0.03
292 0.03
293 0.02
294 0.02
295 0.04
296 0.05
297 0.06
298 0.09
299 0.13
300 0.19
301 0.25
302 0.27
303 0.27
304 0.33
305 0.36
306 0.36
307 0.35
308 0.3
309 0.25
310 0.24
311 0.22
312 0.16
313 0.12
314 0.09
315 0.08
316 0.07
317 0.06
318 0.06
319 0.05
320 0.06
321 0.06
322 0.06
323 0.06
324 0.07
325 0.08
326 0.1
327 0.13
328 0.14
329 0.17
330 0.18
331 0.21
332 0.24
333 0.31
334 0.36
335 0.37
336 0.39
337 0.47
338 0.53
339 0.59
340 0.66
341 0.69
342 0.73
343 0.79
344 0.84
345 0.83
346 0.82
347 0.79
348 0.76
349 0.77
350 0.7
351 0.62
352 0.55
353 0.46
354 0.38
355 0.32
356 0.23
357 0.12
358 0.08
359 0.07
360 0.08
361 0.08
362 0.08
363 0.1
364 0.12
365 0.18
366 0.21
367 0.24
368 0.23
369 0.24
370 0.33
371 0.35
372 0.38
373 0.36
374 0.38
375 0.41
376 0.47
377 0.51
378 0.49
379 0.48
380 0.45
381 0.47
382 0.46
383 0.46
384 0.39
385 0.36
386 0.34
387 0.32
388 0.29
389 0.24
390 0.2
391 0.14
392 0.14
393 0.12
394 0.07
395 0.06
396 0.08
397 0.08
398 0.1
399 0.1
400 0.1
401 0.12
402 0.18
403 0.2
404 0.2
405 0.23
406 0.22
407 0.23
408 0.24
409 0.24
410 0.19
411 0.18
412 0.16
413 0.16
414 0.16
415 0.15
416 0.14
417 0.13
418 0.12
419 0.13
420 0.12
421 0.1
422 0.08
423 0.07
424 0.07
425 0.09
426 0.1
427 0.12
428 0.14
429 0.16
430 0.19
431 0.22