Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L0DJW9

Protein Details
Accession A0A1L0DJW9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
107-132IAQKMHAKKVERMRKKEKRNKLLRERBasic
NLS Segment(s)
PositionSequence
84-132KNRKITELKRRRELREEKERYEKIAQKMHAKKVERMRKKEKRNKLLRER
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSATADKALKDIPKKYIDPLAEKDVGEGPRVNGKEWKIKKDAFRVKTIGVKKLSTWKLREQQKLQQEQYKQRLNDLKQEKEDEKNRKITELKRRRELREEKERYEKIAQKMHAKKVERMRKKEKRNKLLRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.48
4 0.46
5 0.45
6 0.46
7 0.45
8 0.42
9 0.4
10 0.38
11 0.36
12 0.32
13 0.28
14 0.24
15 0.19
16 0.23
17 0.24
18 0.24
19 0.24
20 0.26
21 0.35
22 0.39
23 0.44
24 0.43
25 0.47
26 0.51
27 0.57
28 0.63
29 0.57
30 0.57
31 0.54
32 0.5
33 0.53
34 0.49
35 0.45
36 0.38
37 0.35
38 0.31
39 0.38
40 0.42
41 0.4
42 0.4
43 0.42
44 0.47
45 0.55
46 0.6
47 0.55
48 0.56
49 0.59
50 0.63
51 0.58
52 0.56
53 0.53
54 0.54
55 0.57
56 0.56
57 0.48
58 0.45
59 0.5
60 0.46
61 0.5
62 0.48
63 0.45
64 0.41
65 0.46
66 0.43
67 0.44
68 0.51
69 0.5
70 0.49
71 0.52
72 0.5
73 0.5
74 0.54
75 0.54
76 0.57
77 0.59
78 0.61
79 0.63
80 0.7
81 0.7
82 0.75
83 0.76
84 0.74
85 0.76
86 0.75
87 0.71
88 0.74
89 0.7
90 0.65
91 0.64
92 0.61
93 0.57
94 0.57
95 0.56
96 0.56
97 0.63
98 0.66
99 0.66
100 0.63
101 0.64
102 0.67
103 0.74
104 0.74
105 0.76
106 0.78
107 0.81
108 0.88
109 0.91
110 0.91
111 0.91
112 0.92