Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WT64

Protein Details
Accession A0A1J5WT64    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
173-193QAQTRRSNTSRERDRRTRKPSHydrophilic
NLS Segment(s)
PositionSequence
28-57KREIRKRMGVRGPRKMPSRKAKSAADARKE
187-191RRTRK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MGVKEIEEKMNYGRSHRLVLKMSEELSKREIRKRMGVRGPRKMPSRKAKSAADARKEGPAAPTGVAAEESAEDLQRRIRDFKRKLLERQQRMQIAQKKLQEMEEKLREKTGSGPTGTYAESASKKPKDQVMKLATALTEAGKRETTRSEATPPTRRTIAVPAQNGTKKEHSLQAQTRRSNTSRERDRRTRKPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.41
4 0.43
5 0.4
6 0.42
7 0.43
8 0.39
9 0.38
10 0.38
11 0.35
12 0.32
13 0.33
14 0.37
15 0.37
16 0.42
17 0.47
18 0.46
19 0.54
20 0.58
21 0.64
22 0.66
23 0.72
24 0.73
25 0.77
26 0.78
27 0.76
28 0.77
29 0.75
30 0.75
31 0.76
32 0.76
33 0.74
34 0.73
35 0.69
36 0.69
37 0.72
38 0.7
39 0.65
40 0.6
41 0.53
42 0.51
43 0.47
44 0.39
45 0.31
46 0.24
47 0.19
48 0.15
49 0.15
50 0.11
51 0.1
52 0.1
53 0.08
54 0.06
55 0.05
56 0.06
57 0.05
58 0.06
59 0.06
60 0.06
61 0.09
62 0.11
63 0.13
64 0.18
65 0.24
66 0.34
67 0.38
68 0.46
69 0.54
70 0.57
71 0.62
72 0.68
73 0.71
74 0.68
75 0.7
76 0.68
77 0.61
78 0.57
79 0.57
80 0.54
81 0.5
82 0.48
83 0.44
84 0.4
85 0.37
86 0.38
87 0.34
88 0.29
89 0.31
90 0.34
91 0.33
92 0.32
93 0.33
94 0.3
95 0.27
96 0.29
97 0.28
98 0.22
99 0.21
100 0.21
101 0.2
102 0.22
103 0.21
104 0.16
105 0.11
106 0.11
107 0.13
108 0.15
109 0.21
110 0.23
111 0.24
112 0.27
113 0.33
114 0.38
115 0.39
116 0.46
117 0.44
118 0.43
119 0.42
120 0.4
121 0.34
122 0.26
123 0.23
124 0.15
125 0.13
126 0.11
127 0.12
128 0.13
129 0.14
130 0.16
131 0.18
132 0.21
133 0.23
134 0.25
135 0.28
136 0.34
137 0.41
138 0.48
139 0.48
140 0.49
141 0.46
142 0.44
143 0.42
144 0.42
145 0.43
146 0.42
147 0.42
148 0.39
149 0.45
150 0.49
151 0.48
152 0.45
153 0.41
154 0.37
155 0.37
156 0.41
157 0.38
158 0.44
159 0.51
160 0.56
161 0.61
162 0.63
163 0.65
164 0.65
165 0.63
166 0.62
167 0.62
168 0.63
169 0.65
170 0.69
171 0.75
172 0.78
173 0.87