Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WZS8

Protein Details
Accession A0A1J5WZS8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
146-175WTIRLYVRSEKERRKKMKRMEELKRKVLRLBasic
NLS Segment(s)
PositionSequence
153-186RSEKERRKKMKRMEELKRKVLRLAEKKTATKNKA
Subcellular Location(s) cyto 12, nucl 11, mito 2
Family & Domain DBs
Amino Acid Sequences MHIGILLPLLAVLKAGGNGEKKGEKRKITPMVYNPPSSRLARGKYFEVTKKHDDMVSSTAEEMRVRLENIEEELSREAMLKEKRVREEILLYINQINNEFSDYASLVEGLAEGYTEVIEKEVDALSREINAAPGGDREKIGRKLAWTIRLYVRSEKERRKKMKRMEELKRKVLRLAEKKTATKNKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.11
4 0.13
5 0.14
6 0.19
7 0.25
8 0.28
9 0.38
10 0.45
11 0.47
12 0.5
13 0.59
14 0.65
15 0.64
16 0.68
17 0.66
18 0.69
19 0.67
20 0.67
21 0.58
22 0.52
23 0.51
24 0.44
25 0.42
26 0.38
27 0.39
28 0.39
29 0.42
30 0.41
31 0.42
32 0.46
33 0.47
34 0.46
35 0.48
36 0.47
37 0.46
38 0.45
39 0.41
40 0.35
41 0.32
42 0.28
43 0.23
44 0.19
45 0.16
46 0.15
47 0.15
48 0.14
49 0.11
50 0.11
51 0.1
52 0.1
53 0.1
54 0.1
55 0.1
56 0.11
57 0.13
58 0.11
59 0.11
60 0.11
61 0.11
62 0.1
63 0.1
64 0.09
65 0.13
66 0.14
67 0.19
68 0.24
69 0.27
70 0.3
71 0.31
72 0.32
73 0.28
74 0.29
75 0.25
76 0.23
77 0.19
78 0.17
79 0.16
80 0.16
81 0.15
82 0.13
83 0.11
84 0.08
85 0.09
86 0.08
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.05
94 0.04
95 0.04
96 0.04
97 0.03
98 0.03
99 0.02
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.05
108 0.05
109 0.06
110 0.07
111 0.08
112 0.07
113 0.08
114 0.09
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.09
121 0.1
122 0.11
123 0.11
124 0.13
125 0.2
126 0.24
127 0.26
128 0.26
129 0.26
130 0.33
131 0.38
132 0.44
133 0.38
134 0.39
135 0.42
136 0.45
137 0.47
138 0.45
139 0.47
140 0.48
141 0.56
142 0.62
143 0.66
144 0.72
145 0.79
146 0.83
147 0.86
148 0.88
149 0.9
150 0.9
151 0.9
152 0.91
153 0.91
154 0.9
155 0.9
156 0.87
157 0.77
158 0.71
159 0.68
160 0.67
161 0.66
162 0.65
163 0.65
164 0.65
165 0.69
166 0.75
167 0.78