Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WV92

Protein Details
Accession A0A1J5WV92   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-65VYAATRWKRKKDRLGRDRELFHydrophilic
NLS Segment(s)
PositionSequence
53-55RKK
Subcellular Location(s) cyto 8.5, E.R. 8, cyto_nucl 5.5, extr 3, mito 2, nucl 1.5, plas 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MQHKERGFLYAILLPPVYVYKEEGCSSSFCMSIGLTALMIVPGSVYAATRWKRKKDRLGRDRELFFTPALERRVALPPFLLDQDETETGRGTFRKNRREPLAESDIEPQSYTPPEDKKETPPFAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.14
5 0.11
6 0.12
7 0.13
8 0.17
9 0.18
10 0.18
11 0.18
12 0.18
13 0.2
14 0.19
15 0.17
16 0.14
17 0.14
18 0.12
19 0.11
20 0.11
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.03
29 0.02
30 0.03
31 0.03
32 0.03
33 0.04
34 0.11
35 0.15
36 0.23
37 0.29
38 0.38
39 0.47
40 0.56
41 0.66
42 0.7
43 0.78
44 0.8
45 0.84
46 0.82
47 0.79
48 0.72
49 0.64
50 0.55
51 0.45
52 0.35
53 0.26
54 0.2
55 0.18
56 0.18
57 0.15
58 0.13
59 0.15
60 0.21
61 0.2
62 0.19
63 0.16
64 0.15
65 0.16
66 0.16
67 0.14
68 0.08
69 0.09
70 0.12
71 0.13
72 0.12
73 0.11
74 0.12
75 0.11
76 0.14
77 0.14
78 0.15
79 0.23
80 0.31
81 0.42
82 0.48
83 0.56
84 0.61
85 0.66
86 0.66
87 0.65
88 0.64
89 0.55
90 0.5
91 0.47
92 0.41
93 0.36
94 0.32
95 0.23
96 0.19
97 0.2
98 0.21
99 0.21
100 0.24
101 0.28
102 0.35
103 0.38
104 0.44
105 0.52