Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5WMG2

Protein Details
Accession A0A1J5WMG2   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
183-211KFLMNVSREERRKKRQSKTGKLSWREMYRHydrophilic
NLS Segment(s)
PositionSequence
193-200RRKKRQSK
Subcellular Location(s) nucl 15, cyto_nucl 13.5, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0070603  C:SWI/SNF superfamily-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MHIPVRVDVESEGRKISDVFVMDSRSSDEFDEVFCELFCSDLLLPHEPFKSEILRAIGERKREHREIEGELLEVERKHRGAEIAIRLDLFIDRTRVTDGFLWNLSGEKAVDVFSECYVRENGLPASFVSGVSCSIREQVYNAKKGALIGGGEYLSRLAVELKEENPLPRTPLIRFMSEEEKEKFLMNVSREERRKKRQSKTGKLSWREMYRPQPVCRLEGKVVGTLGEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.18
5 0.16
6 0.17
7 0.19
8 0.22
9 0.21
10 0.22
11 0.23
12 0.2
13 0.2
14 0.18
15 0.17
16 0.13
17 0.14
18 0.15
19 0.13
20 0.12
21 0.11
22 0.11
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.12
29 0.15
30 0.18
31 0.19
32 0.22
33 0.23
34 0.21
35 0.22
36 0.21
37 0.21
38 0.18
39 0.21
40 0.2
41 0.2
42 0.21
43 0.27
44 0.28
45 0.31
46 0.35
47 0.38
48 0.43
49 0.45
50 0.46
51 0.43
52 0.45
53 0.42
54 0.42
55 0.36
56 0.29
57 0.26
58 0.23
59 0.19
60 0.15
61 0.13
62 0.11
63 0.1
64 0.1
65 0.11
66 0.12
67 0.13
68 0.18
69 0.22
70 0.22
71 0.22
72 0.22
73 0.21
74 0.2
75 0.18
76 0.14
77 0.09
78 0.09
79 0.09
80 0.1
81 0.12
82 0.12
83 0.13
84 0.14
85 0.14
86 0.14
87 0.14
88 0.13
89 0.11
90 0.12
91 0.1
92 0.08
93 0.07
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.08
104 0.09
105 0.09
106 0.08
107 0.09
108 0.09
109 0.09
110 0.09
111 0.08
112 0.1
113 0.09
114 0.09
115 0.08
116 0.07
117 0.08
118 0.08
119 0.08
120 0.06
121 0.08
122 0.08
123 0.08
124 0.09
125 0.18
126 0.23
127 0.26
128 0.26
129 0.25
130 0.25
131 0.25
132 0.25
133 0.16
134 0.1
135 0.07
136 0.08
137 0.07
138 0.07
139 0.07
140 0.06
141 0.05
142 0.04
143 0.04
144 0.05
145 0.05
146 0.08
147 0.1
148 0.1
149 0.13
150 0.15
151 0.16
152 0.18
153 0.18
154 0.19
155 0.2
156 0.22
157 0.2
158 0.29
159 0.3
160 0.29
161 0.3
162 0.31
163 0.36
164 0.35
165 0.4
166 0.33
167 0.32
168 0.3
169 0.29
170 0.25
171 0.21
172 0.25
173 0.22
174 0.28
175 0.3
176 0.39
177 0.45
178 0.55
179 0.6
180 0.66
181 0.75
182 0.76
183 0.82
184 0.84
185 0.88
186 0.9
187 0.9
188 0.89
189 0.89
190 0.85
191 0.82
192 0.8
193 0.76
194 0.7
195 0.68
196 0.66
197 0.66
198 0.67
199 0.64
200 0.64
201 0.59
202 0.59
203 0.56
204 0.53
205 0.46
206 0.45
207 0.43
208 0.37
209 0.35