Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J5X0J2

Protein Details
Accession A0A1J5X0J2   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MENKKVTLKKIKKRTKSFVRHHSDRYNRVKKAWRKPKGIDNCVRHydrophilic
NLS Segment(s)
PositionSequence
7-38TLKKIKKRTKSFVRHHSDRYNRVKKAWRKPKG
Subcellular Location(s) nucl 18.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MENKKVTLKKIKKRTKSFVRHHSDRYNRVKKAWRKPKGIDNCVRRKFSGAIPMPGKGYKTDKRTRYLLKNGTYKFPVSNTKDLSSLLMHNKSHSAEIAHGVSARNRIKIIEKAKELGVCVINASARVVTADASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.91
4 0.91
5 0.9
6 0.9
7 0.86
8 0.84
9 0.83
10 0.81
11 0.8
12 0.81
13 0.8
14 0.72
15 0.72
16 0.75
17 0.74
18 0.76
19 0.78
20 0.76
21 0.74
22 0.77
23 0.8
24 0.81
25 0.8
26 0.78
27 0.77
28 0.78
29 0.77
30 0.74
31 0.64
32 0.57
33 0.5
34 0.44
35 0.44
36 0.36
37 0.35
38 0.34
39 0.34
40 0.32
41 0.31
42 0.28
43 0.21
44 0.25
45 0.24
46 0.31
47 0.38
48 0.41
49 0.45
50 0.5
51 0.54
52 0.55
53 0.57
54 0.56
55 0.55
56 0.58
57 0.55
58 0.52
59 0.47
60 0.41
61 0.33
62 0.29
63 0.31
64 0.28
65 0.33
66 0.32
67 0.32
68 0.32
69 0.31
70 0.29
71 0.22
72 0.21
73 0.21
74 0.22
75 0.21
76 0.21
77 0.23
78 0.23
79 0.22
80 0.19
81 0.15
82 0.12
83 0.15
84 0.15
85 0.13
86 0.13
87 0.13
88 0.14
89 0.21
90 0.22
91 0.21
92 0.21
93 0.22
94 0.26
95 0.34
96 0.4
97 0.4
98 0.41
99 0.41
100 0.44
101 0.43
102 0.39
103 0.35
104 0.29
105 0.21
106 0.19
107 0.18
108 0.15
109 0.14
110 0.15
111 0.1
112 0.09
113 0.09
114 0.09