Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J5WJT5

Protein Details
Accession A0A1J5WJT5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-73LKKPDASKSRYNKRVKKLRGKKRRHCGIGKRRGKKTARVDPKKEWRVRBasic
NLS Segment(s)
PositionSequence
28-87KPDASKSRYNKRVKKLRGKKRRHCGIGKRRGKKTARVDPKKEWRVRIKELREILKKQREK
Subcellular Location(s) nucl 18, cyto_nucl 15, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR035970  60S_ribosomal_L19/L19e_sf  
IPR000196  Ribosomal_L19/L19e  
IPR039547  RPL19  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01280  Ribosomal_L19e  
Amino Acid Sequences MLGELLRGCCPYRSSIKTLIEDGLILKKPDASKSRYNKRVKKLRGKKRRHCGIGKRRGKKTARVDPKKEWRVRIKELREILKKQREKGDGTVDRADERNQDTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.47
4 0.47
5 0.48
6 0.43
7 0.35
8 0.3
9 0.26
10 0.23
11 0.19
12 0.17
13 0.15
14 0.17
15 0.18
16 0.25
17 0.28
18 0.29
19 0.36
20 0.46
21 0.56
22 0.63
23 0.72
24 0.73
25 0.78
26 0.83
27 0.83
28 0.85
29 0.85
30 0.86
31 0.87
32 0.9
33 0.9
34 0.9
35 0.9
36 0.86
37 0.84
38 0.84
39 0.84
40 0.84
41 0.83
42 0.81
43 0.76
44 0.78
45 0.72
46 0.71
47 0.7
48 0.7
49 0.71
50 0.73
51 0.74
52 0.75
53 0.82
54 0.83
55 0.77
56 0.75
57 0.73
58 0.72
59 0.74
60 0.75
61 0.69
62 0.67
63 0.69
64 0.7
65 0.67
66 0.66
67 0.67
68 0.67
69 0.67
70 0.65
71 0.68
72 0.63
73 0.61
74 0.6
75 0.61
76 0.57
77 0.57
78 0.56
79 0.48
80 0.46
81 0.44
82 0.4
83 0.34